UniRef · UniRef90_Q9ZZ63 (90%)

  • Cluster name
    ATP synthase protein 8
  • Composition
    73 members
  • Last updated
  • Seed
    Built on sequence Q9ZZ63
  • Common taxon

Representative

  • Length
    67
  • Mass (Da)
    7,978
  • Checksum
    3B313377275A0AC6
MPQLDTSTWFIMIFSMFLTLFILFQLKISNHYYPENPMTKSAKIAGQHNPWENKWTKIYSLLSLPPQ

73 members

Expand cluster to 50% identity · List component clusters with 100% identity
Cluster MembersEntry namesProtein namesOrganismsOrganism IDsRelated clustersLengthsRoles
ATP8_CANLFATP synthase protein 8Canis lupus familiaris (Dog) (Canis familiaris)9615UniRef50_P03929 UniRef100_Q9ZZ6367seed & representative
ATP8_CANLUATP synthase protein 8Canis lupus (Gray wolf)9612UniRef100_Q9ZZ6367
A6Q067_CANLUATP synthase protein 8Canis lupus lupus (Eurasian wolf)443256UniRef100_Q9ZZ6367
C4MX05_CANLUATP synthase protein 8Canis lupus (Gray wolf)9612UniRef100_Q9ZZ6367
Q49RZ8_CANLFATP synthase protein 8Canis lupus familiaris (Dog) (Canis familiaris)9615UniRef100_Q9ZZ6367
R9TDV2_CANLUATP synthase protein 8Canis lupus campestris (steppe wolf)1341016UniRef100_Q9ZZ6367
A0A5C0CJE1_CANLUATP synthase protein 8Canis lupus orion (Greenland wolf)2605939UniRef100_Q9ZZ6367
M1Q372_CANLUATP synthase protein 8Canis lupus desertorum1295334UniRef100_Q9ZZ6367
V5LK36_9CARNATP synthase protein 8Canis sp. Russia/33,5001419712UniRef100_Q9ZZ6367
H8Y5C1_CANLFATP synthase protein 8 (Fragment)Canis lupus familiaris (Dog) (Canis familiaris)9615UniRef100_Q9ZZ6365
A0A6B9LXY1_CANLUATP synthase protein 8 (Fragment)Canis lupus (Gray wolf)9612UniRef100_Q9ZZ6346
A0A6B9M0B9_CANLUATP synthase F0 subunit 8 (Fragment)Canis lupus (Gray wolf)9612UniRef100_Q9ZZ6335
V5LK29_CANLFATP synthase F0 subunit 8 (Fragment)Canis lupus familiaris (Dog) (Canis familiaris)9615UniRef100_Q9ZZ6335
A0A6B9M8K8_CANLUATP synthase protein 8 (Fragment)Canis lupus (Gray wolf)9612UniRef100_Q9ZZ6331
A0A6B9M419_CANLUATP synthase F0 subunit 8 (Fragment)Canis lupus (Gray wolf)9612UniRef100_Q9ZZ6318
B5TY22_CANLUATP synthase protein 8Canis lupus laniger (Tibetan wolf)554455UniRef50_P03929 UniRef100_B5TY2267
A0A1L2BP37_CANLUATP synthase protein 8Canis lupus (Gray wolf)9612UniRef100_B5TY2267
B1AC74_CANLUATP synthase protein 8Canis lupus chanco (Mongolian wolf)246881UniRef100_B5TY2267
A0A172RAV4_CANLFATP synthase protein 8Canis lupus familiaris (Dog) (Canis familiaris)9615UniRef50_P03929 UniRef100_A0A172RAV467
A0A8F3HRZ5_CANLAATP synthase protein 8Canis latrans (Coyote)9614UniRef50_P03929 UniRef100_A0A8F3HRZ567
A0A344AL37_CANLFATP synthase protein 8Canis lupus familiaris (Dog) (Canis familiaris)9615UniRef50_P03929 UniRef100_A0A344AL3767
A0A8F3CGB9_CANLAATP synthase protein 8Canis latrans (Coyote)9614UniRef50_P03929 UniRef100_A0A8F3CGB967
A0A344AL26_CANLFATP synthase protein 8Canis lupus familiaris (Dog) (Canis familiaris)9615UniRef50_P03929 UniRef100_A0A344AL2667
B9TYB1_CANLFATP synthase protein 8Canis lupus familiaris (Dog) (Canis familiaris)9615UniRef50_P03929 UniRef100_B9TYB167
V5LKS8_CANLUATP synthase protein 8Canis lupus (Gray wolf)9612UniRef50_P03929 UniRef100_V5LKS867
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
Help