UniRef · UniRef90_Q32643 (90%)

  • Cluster name
    ATP synthase protein 8
  • Composition
    18 members
  • Last updated
  • Seed
    Built on sequence Q32643
  • Common taxon

Representative

  • Length
    65
  • Mass (Da)
    7,799
  • Checksum
    D55AE5CFD04C3AC3
MPQLDTSTWLTTILSMFLALFIIFQLKISKYDFYHNPELTAKMLKHNTPWETKWTKIYLPLLLPL

18 members

Expand cluster to 50% identity · List component clusters with 100% identity
Cluster MembersEntry namesProtein namesOrganismsOrganism IDsRelated clustersLengthsRoles
ATP8_CAPHIATP synthase protein 8Capra hircus (Goat)9925UniRef50_P03929 UniRef100_Q3264365seed & representative
ATP8_CAPIIATP synthase protein 8Capra ibex ibex (Alpine ibex)80420UniRef50_P03929 UniRef100_Q9MQK265
D0VEF8_CAPHIATP synthase protein 8Capra hircus (Goat)9925UniRef100_Q3264365
A0A0N9M007_CAPHEATP synthase protein 8Capra hircus aegagrus (Wild goat) (Capra aegagrus)9923UniRef100_Q3264365
S6AMC9_CAPHIATP synthase protein 8Capra hircus (Goat)9925UniRef50_P03929 UniRef100_S6AMC965
A0A1S6YF96_CAPHIATP synthase protein 8Capra hircus (Goat)9925UniRef50_P03929 UniRef100_A0A1S6YF9665
C3TVJ5_9CETAATP synthase protein 8Capra pyrenaica (Spanish ibex)80419UniRef50_P03929 UniRef100_C3TVJ565
A0A1S6YF32_CAPHIATP synthase protein 8Capra hircus (Goat)9925UniRef50_P03929 UniRef100_A0A1S6YF3265
C3TVF6_CAPFAATP synthase protein 8Capra falconeri (Markhor)48167UniRef50_P03929 UniRef100_C3TVF665
S6B528_CAPHIATP synthase protein 8Capra hircus (Goat)9925UniRef50_P03929 UniRef100_S6B52865
C3TVG9_CAPIBATP synthase protein 8Capra ibex (Ibex)72542UniRef100_Q9MQK265
A0A0U2EXZ9_CAPHEATP synthase protein 8Capra hircus aegagrus (Wild goat) (Capra aegagrus)9923UniRef50_P03929 UniRef100_A0A0U2EXZ965
A0A0U2EXA1_CAPHIATP synthase protein 8Capra hircus (Goat)9925UniRef50_P03929 UniRef100_A0A0U2EXA165
H6U9Y1_CAPCUATP synthase protein 8Capra caucasica (West Caucasian tur)72540UniRef50_P03929 UniRef100_H6U9Y165
A0A0U2EXR7_CAPHIATP synthase protein 8Capra hircus (Goat)9925UniRef50_P03929 UniRef100_A0A0U2EXR765
C3TVI2_CAPNUATP synthase protein 8Capra nubiana (Nubian ibex) (Capra ibex nubiana)72543UniRef50_P03929 UniRef100_C3TVI265
A0A5Q2MQG7_CAPHIATP synthase protein 8Capra hircus (Goat)9925UniRef50_P03929 UniRef100_A0A5Q2MQG765
A0A109P3V8_CAPHIATP synthase protein 8Capra hircus (Goat)9925UniRef50_P03929 UniRef100_A0A109P3V865
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
Help