UniRef · UniRef90_P37173-3 (90%)
- Cluster nameIsoform 3 of TGF-beta receptor type-2
- Last updated
- SeedBuilt on sequence P37173-3
- Common taxon
Representative
- Length80
- Mass (Da)9,162
- Checksum0ED06AD96E73249F
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCFSKVHYEGKKKAW
1 member
Cluster Members | Entry names | Protein names | Organisms | Organism IDs | Related clusters | Lengths | Roles | ||
---|---|---|---|---|---|---|---|---|---|
P37173-3 | Isoform 3 of TGF-beta receptor type-2 | Homo sapiens (Human) | 9606 | UniRef50_P37173-3 UniRef100_P37173-3 | 80 | seed & representative |