Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P29946 Cobyrinate a,c-diamide synthase n=374 Tax=Salmonella TaxID=590 RepID=CBIA_SALTY MAARHHAFILAGTGSGCGKTTVTLGLLRLLQKRALRVQPFKVGPDYLDTGWHTAICGVAS RNLDSFMLPPPVLNALFCEQMRQADIAVIEGVMGLYDGYGVDPNYCSTAAMAKQLGCPVI LLVDGKAVSTSLAATVMGFQHFDPTLNLAGVIVNRVTSDAHYQLLKNAIEHYCSLPVLGY VPPCDGVALPERHLGLITARESLVNQQSWHDFAATLEQTVDVDALLSLSVLSALPAGMWP ERPDNTAGAGLTLALADDEAFNFYYPDNIDLLERAGVNIVRFSPLHDRALPDCQMIWLGG GYPELYAADLAANTVMLKHLRAAHQRGVAIYAECGGLMYLGSTLEDSGGEIHQMANIIPG HSKMGKRLTRFGYCEAQAMQPTLLAAPGEIVRGHEFHYSDFIPETPAVMACRKVRDGRVL QEWTGGWQTGNTFASYLHVHFAQRPEMLQHWLAAARRVL

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 374  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P29946CBIA_SALTYCobyrinate a,c-diamide synthaseSalmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)99287UniRef100_P29946
459Representative
A0A3Z0CFY0A0A3Z0CFY0_SALETCobyrinate a,c-diamide synthaseSalmonella enterica subsp. enterica serovar Haifa192956UniRef100_P29946
459
A0A3Z2F841A0A3Z2F841_SALTUCobyrinate a,c-diamide synthaseSalmonella typhimurium (strain ATCC 68169 / UK-1)990282UniRef100_P29946
459
A0A509C8T4A0A509C8T4_9ENTRCobyrinate a,c-diamide synthaseSalmonella sp. NCTC 118812583579UniRef100_P29946
459
A0A3V4QP42A0A3V4QP42_SALETCobyrinate a,c-diamide synthaseSalmonella enterica subsp. enterica serovar Kottbus224727UniRef100_P29946
459
A0A3U8IPH8A0A3U8IPH8_SALETCobyrinate a,c-diamide synthaseSalmonella enterica subsp. enterica serovar Saintpaul90105UniRef100_P29946
459
A0A3Z2KJ85A0A3Z2KJ85_SALETCobyrinate a,c-diamide synthaseSalmonella enterica I59201UniRef100_P29946
459
A0A315GRH3A0A315GRH3_SALETCobyrinate a,c-diamide synthaseSalmonella enterica subsp. enterica serovar 4,[5],12:i:-440524UniRef100_P29946
459
A0A0W4XY11A0A0W4XY11_SALERCobyrinate a,c-diamide synthaseSalmonella enterica (Salmonella choleraesuis)28901UniRef100_P29946
459
A0A0F7J7P0A0A0F7J7P0_SALTMCobyrinate a,c-diamide synthaseSalmonella typhimurium90371UniRef100_P29946
459
E8XBY9E8XBY9_SALT4Cobyrinate a,c-diamide synthaseSalmonella typhimurium (strain 4/74)909946UniRef100_P29946
459
A0A0H3NCY8A0A0H3NCY8_SALTSCobyrinate a,c-diamide synthaseSalmonella typhimurium (strain SL1344)216597UniRef100_P29946
459
A0A0F6B379A0A0F6B379_SALT1Cobyrinate a,c-diamide synthaseSalmonella typhimurium (strain 14028s / SGSC 2262)588858UniRef100_P29946
459
A0A2T8RD04A0A2T8RD04_SALETCobyrinate a,c-diamide synthaseSalmonella enterica subsp. enterica serovar 4,12:i:-353569UniRef100_P29946
459
A0A4Q8PMA4A0A4Q8PMA4_SALETCobyrinate a,c-diamide synthaseSalmonella enterica subsp. enterica serovar Albany211968UniRef100_P29946
459
A0A4P9T664A0A4P9T664_SALETCobyrinate a,c-diamide synthaseSalmonella enterica subsp. enterica serovar 1,4,[5],12:i:-2583588UniRef100_P29946
459
G5LQE0G5LQE0_SALETCobyrinic acid A,C-diamide synthaseSalmonella enterica subsp. enterica serovar Alachua str. R6-377913241UniRef100_P29946
165
A0A3X7FAC6A0A3X7FAC6_SALERCobyrinic acid a,c-diamide synthase (Fragment)Salmonella enterica (Salmonella choleraesuis)28901UniRef100_P29946
161
A0A3X7F028A0A3X7F028_SALERCobyrinate a,c-diamide synthase (Fragment)Salmonella enterica (Salmonella choleraesuis)28901UniRef100_P29946
290
A0A379VPR8A0A379VPR8_SALETCobyrinate a,c-diamide synthaseSalmonella enterica I59201UniRef100_A0A379VPR8
506Seed
A0A3U4IRL4A0A3U4IRL4_SALETCobyrinate a,c-diamide synthaseSalmonella enterica I59201UniRef100_A0A3U4IRL4
459
A0A5C2LV87A0A5C2LV87_SALERCobyrinate a,c-diamide synthaseSalmonella enterica (Salmonella choleraesuis)28901UniRef100_A0A5C2LV87
459
A0A3X9BQA3A0A3X9BQA3_SALETCobyrinate a,c-diamide synthaseSalmonella enterica I59201UniRef100_A0A5C2LV87
459
C0Q1P1C0Q1P1_SALPCCobyrinate a,c-diamide synthaseSalmonella paratyphi C (strain RKS4594)476213UniRef100_A0A5C2LV87
459
A0A3T8X1D4A0A3T8X1D4_SALETCobyrinate a,c-diamide synthaseSalmonella enterica I59201UniRef100_A0A3T8X1D4
459

Sequence

Representative sequenceiLengthMass (Da)Tools
P29946

Checksumi: E1FEF1B5A37F5C14

FASTA45950,036
        10         20         30         40         50
MAARHHAFIL AGTGSGCGKT TVTLGLLRLL QKRALRVQPF KVGPDYLDTG
60 70 80 90 100
WHTAICGVAS RNLDSFMLPP PVLNALFCEQ MRQADIAVIE GVMGLYDGYG
110 120 130 140 150
VDPNYCSTAA MAKQLGCPVI LLVDGKAVST SLAATVMGFQ HFDPTLNLAG
160 170 180 190 200
VIVNRVTSDA HYQLLKNAIE HYCSLPVLGY VPPCDGVALP ERHLGLITAR
210 220 230 240 250
ESLVNQQSWH DFAATLEQTV DVDALLSLSV LSALPAGMWP ERPDNTAGAG
260 270 280 290 300
LTLALADDEA FNFYYPDNID LLERAGVNIV RFSPLHDRAL PDCQMIWLGG
310 320 330 340 350
GYPELYAADL AANTVMLKHL RAAHQRGVAI YAECGGLMYL GSTLEDSGGE
360 370 380 390 400
IHQMANIIPG HSKMGKRLTR FGYCEAQAMQ PTLLAAPGEI VRGHEFHYSD
410 420 430 440 450
FIPETPAVMA CRKVRDGRVL QEWTGGWQTG NTFASYLHVH FAQRPEMLQH

WLAAARRVL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again