Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_P28161 Glutathione S-transferase Mu 2 n=25 Tax=Simiiformes TaxID=314293 RepID=GSTM2_HUMAN MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL PYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF EKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPN LKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 25  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P28161GSTM2_HUMANGlutathione S-transferase Mu 2Homo sapiens (Human)9606UniRef100_P28161
218Representative
Q5R8E8GSTM2_PONABGlutathione S-transferase Mu 2Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q5R8E8
218
A0A384P5E9A0A384P5E9_HUMANGlutathione S-transferaseHomo sapiens (Human)9606UniRef100_P28161
218
G7MIE7G7MIE7_MACMUGlutathione S-transferaseMacaca mulatta (Rhesus macaque)9544UniRef100_G7MIE7
237
A0A2K5ZH73A0A2K5ZH73_MANLEGlutathione S-transferaseMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5ZH73
221
Q0D2I8Q0D2I8_HUMANGlutathione S-transferaseHomo sapiens (Human)9606UniRef100_Q0D2I8
218
U3DP35U3DP35_CALJAGlutathione S-transferase Mu 2 isoform 1Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_U3DP35
218
A0A2K6RGH8A0A2K6RGH8_RHIROGlutathione S-transferaseRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6RGH8
218
U3FGA5U3FGA5_CALJAGlutathione S-transferase Mu 2 isoform 1Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_U3FGA5
218
A0A2K5ZH82A0A2K5ZH82_MANLEGlutathione S-transferaseMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5ZH82
218
U3BQG3U3BQG3_CALJAGlutathione S-transferase Mu 2 isoform 1Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_U3BQG3
218
U3FGA7U3FGA7_CALJAGlutathione S-transferase Mu 2 isoform 1Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_U3FGA7
218
A0A2I3GHY1A0A2I3GHY1_NOMLEGlutathione S-transferaseNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3GHY1
218
H2N6H3H2N6H3_PONABGST N-terminal domain-containing proteinPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q5R8E8
87
U3FKJ6U3FKJ6_CALJAGlutathione S-transferase Mu 2 isoform 1Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_U3FKJ6
218
U3E8F2U3E8F2_CALJAGlutathione S-transferase Mu 2 isoform 1Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_U3E8F2
218
G3R0J5G3R0J5_GORGOUncharacterized proteinGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3R0J5
218
A0A096MWS4A0A096MWS4_PAPANGlutathione S-transferasePapio anubis (Olive baboon)9555UniRef100_A0A096MWS4
217
A0A2K6RGK9A0A2K6RGK9_RHIROGlutathione S-transferaseRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6RGK9
217
G3QR13G3QR13_GORGOUncharacterized proteinGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3QR13
214
UPI00001119ECGlutathione S-transferase Mu 2Homo sapiens (Human)9606UniRef100_P28161
217
UPI00075FF0C9glutathione S-transferase Mu 2 isoform X1Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_UPI00075FF0C9
248Seed
UPI00005DB39CGLUTATHIONE S-TRANSFERASE MU 2Homo sapiens (Human)9606UniRef100_UPI00005DB39C
218
UPI0000111BD5GLUTATHIONE S-TRANSFERASEHomo sapiens (Human)9606UniRef100_UPI0000111BD5
217
UPI00027F218ALOW QUALITY PROTEIN: glutathione S-transferase Mu 2Papio anubis (Olive baboon)9555UniRef100_UPI00027F218A
217

Sequence

Representative sequenceiLengthMass (Da)Tools
P28161

Checksumi: 15203709D4A63789

FASTA21825,745
        10         20         30         40         50
MPMTLGYWNI RGLAHSIRLL LEYTDSSYEE KKYTMGDAPD YDRSQWLNEK
60 70 80 90 100
FKLGLDFPNL PYLIDGTHKI TQSNAILRYI ARKHNLCGES EKEQIREDIL
110 120 130 140 150
ENQFMDSRMQ LAKLCYDPDF EKLKPEYLQA LPEMLKLYSQ FLGKQPWFLG
160 170 180 190 200
DKITFVDFIA YDVLERNQVF EPSCLDAFPN LKDFISRFEG LEKISAYMKS
210
SRFLPRPVFT KMAVWGNK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again