Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_O52199 Deoxyguanosinetriphosphate triphosphohydrolase-like protein n=5 Tax=Mycobacteriaceae TaxID=1762 RepID=DGTL1_MYCS2 MNATQYDHYDDFDRERLVPEPAKSAALPGTDTEHRTDFARDRARVLHCAALRRLADKTQV VGPRHGDNPRTRLTHSLEVAQIGRGMAIGLGCDPDLVDLAGLAHDIGHPPYGHNGERALN EIAKAFGGFEGNAQNFRILTRLEPKVLDADGRSAGLNLTRASLDAVTKYPWRRTEERRKF GFYVGFPDDDGPAADWVRDGAPVDRPCLEAQVMDWADDVAYSVHDVEDGVISGRIDLRVL ADADAAESLAQLGAAAFPSLAHDDLLAAAQRLSEMPVVAAVGKYDGTLAASVALKRLTSE LVGRFANAAITETRAVAGDRPLKRFDSDLVVPDLVRAEVAVLKMLALQFIMSDHQHLQVQ ADQRTRIHEVALALWAQAPGSLDPQFAPEFAAAGDDGARLRVVIDQIASYTETRLERVHE ARSPRPLE

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 5 of 5  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
O52199DGTL1_MYCS2Deoxyguanosinetriphosphate triphosphohydrolase-like proteinMycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis)246196UniRef100_O52199
428Representative & Seed
A0A2U9PU96A0A2U9PU96_MYCSEDeoxyguanosinetriphosphate triphosphohydrolase-like proteinMycolicibacterium smegmatis (strain MKD8) (Mycobacterium smegmatis)1214915UniRef100_O52199
428
A0A0D6INL3A0A0D6INL3_MYCSMDeoxyguanosinetriphosphate triphosphohydrolase-like proteinMycolicibacterium smegmatis (Mycobacterium smegmatis)1772UniRef100_O52199
428
A0A1Q4TJQ2A0A1Q4TJQ2_9MYCODeoxyguanosinetriphosphate triphosphohydrolase-like proteinMycobacterium sp. SWH-M51490483UniRef100_A0A1Q4TJQ2
428
A0A2M9FG67A0A2M9FG67_MYCGDDeoxyguanosinetriphosphate triphosphohydrolase-like proteinMycobacterium goodii (Mycolicibacterium goodii)134601UniRef100_A0A2M9FG67
428

Sequence

Representative sequenceiLengthMass (Da)Tools
O52199

Checksumi: C7475B2A0DFD38DE

FASTA42846,744
        10         20         30         40         50
MNATQYDHYD DFDRERLVPE PAKSAALPGT DTEHRTDFAR DRARVLHCAA
60 70 80 90 100
LRRLADKTQV VGPRHGDNPR TRLTHSLEVA QIGRGMAIGL GCDPDLVDLA
110 120 130 140 150
GLAHDIGHPP YGHNGERALN EIAKAFGGFE GNAQNFRILT RLEPKVLDAD
160 170 180 190 200
GRSAGLNLTR ASLDAVTKYP WRRTEERRKF GFYVGFPDDD GPAADWVRDG
210 220 230 240 250
APVDRPCLEA QVMDWADDVA YSVHDVEDGV ISGRIDLRVL ADADAAESLA
260 270 280 290 300
QLGAAAFPSL AHDDLLAAAQ RLSEMPVVAA VGKYDGTLAA SVALKRLTSE
310 320 330 340 350
LVGRFANAAI TETRAVAGDR PLKRFDSDLV VPDLVRAEVA VLKMLALQFI
360 370 380 390 400
MSDHQHLQVQ ADQRTRIHEV ALALWAQAPG SLDPQFAPEF AAAGDDGARL
410 420
RVVIDQIASY TETRLERVHE ARSPRPLE
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again