Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_O08343 Uncharacterized metal-dependent hydrolase TatD n=60 Tax=Mycobacterium tuberculosis complex TaxID=77643 RepID=TATD_MYCTU MVDAHTHLDACGARDADTVRSLVERAAAAGVTAVVTVADDLESARWVTRAAEWDRRVYAA VALHPTRADALTDAARAELERLVAHPRVVAVGETGIDMYWPGRLDGCAEPHVQREAFAWH IDLAKRTGKPLMIHNRQADRDVLDVLRAEGAPDTVILHCFSSDAAMARTCVDAGWLLSLS GTVSFRTARELREAVPLMPVEQLLVETDAPYLTPHPHRGLANEPYCLPYTVRALAELVNR RPEEVALITTSNARRAYGLGWMRQ

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 60  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
O08343TATD_MYCTUUncharacterized metal-dependent hydrolase TatDMycobacterium tuberculosis (strain ATCC 25618 / H37Rv)83332UniRef100_O08343
264Representative
A5U151A5U151_MYCTAPutative deoxyribonuclease TatDMycobacterium tuberculosis (strain ATCC 25177 / H37Ra)419947UniRef100_O08343
264
A0A0E7YUK4A0A0E7YUK4_MYCTXDeoxyribonucleaseMycobacterium tuberculosis1773UniRef100_A0A0E7YUK4
286Seed
A0A0H3L7G3A0A0H3L7G3_MYCTEDeoxyribonucleaseMycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman)652616UniRef100_A0A0E7YUK4
286
Q8VK95Q8VK95_MYCTOUncharacterized proteinMycobacterium tuberculosis (strain CDC 1551 / Oshkosh)83331UniRef100_A0A0E7YUK4
167
A0A2R9SG52A0A2R9SG52_MYCTXDeoxyribonucleaseMycobacterium tuberculosis1773UniRef100_A0A2R9SG52
286
A0A4U7MKL8A0A4U7MKL8_MYCBIDNAaseMycobacterium bovis1765UniRef100_A0A4U7MKL8
264
A0A045INU6A0A045INU6_MYCTXDeoxyribonucleaseMycobacterium tuberculosis1773UniRef100_A0A4U7MKL8
264
A0A328GUK9A0A328GUK9_MYCTXYchF/TatD family DNA exonucleaseMycobacterium tuberculosis variant pinnipedii194542UniRef100_A0A4U7MKL8
264
A0A501P301A0A501P301_9MYCOYchF/TatD family DNA exonucleaseMycobacterium orygis1305738UniRef100_A0A4U7MKL8
264
A0A1R3XXF5A0A1R3XXF5_MYCBOProbable deoxyribonuclease TatD (YjjV protein)Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)233413UniRef100_A0A4U7MKL8
264
A0A0H3M2Y7A0A0H3M2Y7_MYCBPProbable deoxyribonuclease TatD (YjjV protein)Mycobacterium bovis (strain BCG / Pasteur 1173P2)410289UniRef100_A0A4U7MKL8
264
A0A109SV43A0A109SV43_MYCTXDeoxyribonuclease TatDMycobacterium tuberculosis variant africanum33894UniRef100_A0A4U7MKL8
264
G0TGC0G0TGC0_MYCCPPutative deoxyribonuclease TATD (YJJV protein)Mycobacterium canettii (strain CIPT 140010059)1048245UniRef100_A0A4U7MKL8
264
A0A109S6V2A0A109S6V2_MYCBIDeoxyribonuclease TatDMycobacterium tuberculosis variant bovis BCG33892UniRef100_A0A109S6V2
240
UPI00069630BETatD family hydrolaseMycobacterium tuberculosis1773UniRef100_A0A0E7YUK4
243
UPI000696351ATatD family hydrolaseMycobacterium tuberculosis1773UniRef100_A0A0E7YUK4
237
UPI000697B062TatD family hydrolaseMycobacterium tuberculosis1773UniRef100_A0A0E7YUK4
208
UPI00067C1FA7TatD family hydrolaseMycobacterium tuberculosis1773UniRef100_A0A0E7YUK4
199
UPI000A22E62ATatD family hydrolaseMycobacterium tuberculosis1773UniRef100_A0A0E7YUK4
233
UPI000697D0EBTatD family hydrolaseMycobacterium tuberculosis1773UniRef100_A0A0E7YUK4
219
UPI0004941720TatD family hydrolaseMycobacterium tuberculosis1773UniRef100_A0A0E7YUK4
235
UPI00069613A1TatD family hydrolaseMycobacterium tuberculosis1773UniRef100_A0A0E7YUK4
190
UPI000E28B88ETatD family hydrolaseMycobacterium tuberculosis1773UniRef100_A0A0E7YUK4
192
UPI001249A74DYchF/TatD family DNA exonucleaseMycobacterium tuberculosis1773UniRef100_UPI001249A74D
264

Sequence

Representative sequenceiLengthMass (Da)Tools
O08343

Checksumi: 3F395346165982AB

FASTA26429,083
        10         20         30         40         50
MVDAHTHLDA CGARDADTVR SLVERAAAAG VTAVVTVADD LESARWVTRA
60 70 80 90 100
AEWDRRVYAA VALHPTRADA LTDAARAELE RLVAHPRVVA VGETGIDMYW
110 120 130 140 150
PGRLDGCAEP HVQREAFAWH IDLAKRTGKP LMIHNRQADR DVLDVLRAEG
160 170 180 190 200
APDTVILHCF SSDAAMARTC VDAGWLLSLS GTVSFRTARE LREAVPLMPV
210 220 230 240 250
EQLLVETDAP YLTPHPHRGL ANEPYCLPYT VRALAELVNR RPEEVALITT
260
SNARRAYGLG WMRQ
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again