UniRef · UniRef90_F8WDQ2 (90%)
- Cluster nameAnkyrin repeat, SAM and basic leucine zipper domain containing 1
- Last updated
- SeedBuilt on sequence F8WDQ2
- Common taxon
Representative
- Length148
- Mass (Da)16,089
- ChecksumBB74F25DFB42AE2B
MAASALRGLPVAGGGESSESEDDGWEIGYLDRTSQKLKRLLPIEEKKEKFKKAMTIGDVSLVQELLDSGISVDSNFQYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQSILITACSAHGSEEQILKCVELLLSRNADPNVACRL
3 members
Cluster Members | Entry names | Protein names | Organisms | Organism IDs | Related clusters | Lengths | Roles | ||
---|---|---|---|---|---|---|---|---|---|
F8WDQ2_HUMAN | Ankyrin repeat, SAM and basic leucine zipper domain containing 1 | Homo sapiens (Human) | 9606 | UniRef50_A0A8C0ZLK2 UniRef100_F8WDQ2 | 148 | seed & representative | |||
A0A2J8QXE6_PANTR | ASZ1 isoform 3 | Pan troglodytes (Chimpanzee) | 9598 | UniRef50_A0A8C0ZLK2 UniRef100_A0A2J8QXE6 | 148 | ||||
A0A2J8UPC7_PONAB | ASZ1 isoform 3 | Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii) | 9601 | UniRef50_A0A8C0ZLK2 UniRef100_A0A2J8UPC7 | 148 |