Essential maintenance is planned to begin on Fri Jan 24 2025. The website may be temporarily unavailable. Please use our fallback: https://wwwdev.ebi.ac.uk/uniprot/front-end/fallback/ in case of any outage.

UniRef · UniRef90_E7CH67 (90%)

  • Cluster name
    Cytochrome c oxidase subunit 1 (Fragment)
  • Composition
    6 members
  • Last updated
  • Seed
    Built on sequence E7CH67
  • Common taxon

Representative

  • Length
    276
  • Mass (Da)
    29,995
  • MD5 Checksum
    5EEB30701F58A368DC77DDB87FC1D5DF
DIGSLYFLAGIWFGLVGTSMSNIIRAELSMSGSLLGDDQIYNVMVTGHAFVMIFFMVMPIMIGGFGNWLVPLMLGSVDMSFPRMNNMSFWLLIPAFMLLFLSSMIESGVGTGWTVYPPLSSSMGHGGLAVDCAIFSLHLAGISSILGAVNFMTTVLNMRNLSMSLDRIPLFVWAVFITAVLLLLSLPVLAGAITMLLLDRNLNTSFFNPVGGGDPILYQHLFWFFGHPEVYILILPGFGVISHVVTQSSSKVSVFGSLGMIYAMVSIGFLGFIVWA

6 members

Expand cluster to 50% identity · List component clusters with 100% identity
Cluster MembersEntry namesProtein namesOrganismsOrganism IDsRelated clustersLengthsRoles
E7CH67_9CRUSCytochrome c oxidase subunit 1 (Fragment)Lestrigonus bengalensis749007UniRef50_A0A4D6PF32 UniRef100_E7CH67276seed & representative
A9Q9X6_9CRUSCytochrome c oxidase subunit 1 (Fragment)Lestrigonus schizogeneios472073UniRef50_A0A4D6PF32 UniRef100_A9Q9X6271
A9Q9X5_9CRUSCytochrome c oxidase subunit 1 (Fragment)Phronimopsis spinifera472155UniRef50_A0A4D6PF32 UniRef100_A9Q9X5249
A0A8K1B1K0_9CRUSCytochrome c oxidase subunit 1 (Fragment)Phronimopsis spinifera472155UniRef100_A9Q9X5219
A0A8K1B183_9CRUSCytochrome c oxidase subunit 1 (Fragment)Phronimopsis spinifera472155UniRef100_A9Q9X5205
E7CH68_9CRUSCytochrome c oxidase subunit 1 (Fragment)Lestrigonus sp. RW-2010940426UniRef50_A0A4D6PF32 UniRef100_E7CH68226
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
Help