UniRef · UniRef90_A0A8C9N9G7 (90%)

  • Cluster name
    Elongation of very long chain fatty acids protein 5
  • Composition
    24 members
  • Last updated
  • Seed
    Built on sequence A0A8C3QXM0
  • Common taxon

Representative

  • Length
    295
  • Mass (Da)
    35,017
  • MD5 Checksum
    12EEBCF9DB5177811F14BD9C78E0CD50
MELVDKTINSYFDVWLGPRDPRVKGWLLLENYTPTFIFSALYLLIVWLGPKYMRNKQPFSCRGILVIYNLGLTLLSLYMFYELVTGVFEGGYNFFCQDTHSGGEADMKIIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHATMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSAVPAMRPYLWWKKYITQGQLIQFVLTIFQTSCGVVWPCAFPMGWLYFQISYMISLIILFTNFYIQTYNKKASSRRKEYQNGSTAIANGYTNSFSSLENNVKQRKQRKD

24 members

Expand cluster to 50% identity · List component clusters with 100% identity
Cluster MembersEntry namesProtein namesOrganismsOrganism IDsRelated clustersLengthsRoles
A0A8C9N9G7_SERCAElongation of very long chain fatty acids protein 5Serinus canaria (Island canary) (Fringilla canaria)9135UniRef50_Q9NYP7 UniRef100_A0A8C9N9G7295representative
A0A8C3QXM0_9PASSElongation of very long chain fatty acids protein 5Cyanoderma ruficeps (rufous-capped babbler)181631UniRef50_Q9NYP7 UniRef100_A0A8C3QXM0356seed
A0A851QYX4_TYCCOElongation of very long chain fatty acids protein (Fragment)Tychaedon coryphoeus (Karoo scrub-robin) (Erythropygia coryphaeus)614051UniRef100_A0A8C3QXM0295
A0A7K8DHR4_9CORVElongation of very long chain fatty acids protein (Fragment)Eulacestoma nigropectus (wattled ploughbill)461239UniRef100_A0A8C3QXM0295
A0A852MHX3_9PASSElongation of very long chain fatty acids protein (Fragment)Pteruthius melanotis357074UniRef100_A0A8C3QXM0295
A0A7K7XJR4_9PASSElongation of very long chain fatty acids protein (Fragment)Mohoua ochrocephala874463UniRef100_A0A8C3QXM0295
A0A7K7ZBM4_9PASEElongation of very long chain fatty acids protein (Fragment)Melanocharis versteri (Fan-tailed berrypecker)254552UniRef100_A0A8C3QXM0295
A0A7K6FH41_9CORVElongation of very long chain fatty acids protein (Fragment)Daphoenositta chrysoptera (varied sittella)254528UniRef100_A0A8C3QXM0295
A0A7K7GLT0_ERIRUElongation of very long chain fatty acids protein (Fragment)Erithacus rubecula (European robin)37610UniRef100_A0A8C3QXM0295
A0A7K8B291_9CORVElongation of very long chain fatty acids protein (Fragment)Cnemophilus loriae (Loria's bird-of-paradise)254448UniRef100_A0A8C3QXM0295
A0A7L1ZMA4_LEILUElongation of very long chain fatty acids protein (Fragment)Leiothrix lutea (Red-billed leiothrix) (Sylvia lutea)36275UniRef100_A0A8C3QXM0295
A0A674H7L5_TAEGUElongation of very long chain fatty acids protein 5Taeniopygia guttata (Zebra finch) (Poephila guttata)59729UniRef50_Q9NYP7 UniRef100_A0A674H7L5317
A0A8C3QY06_9PASSElongation of very long chain fatty acids protein 5Cyanoderma ruficeps (rufous-capped babbler)181631UniRef50_Q9NYP7 UniRef100_A0A8C3QY06315
A0A8C3ETP9_CORMOElongation of very long chain fatty acids protein 5Corvus moneduloides (New Caledonian crow)1196302UniRef50_Q9NYP7 UniRef100_A0A8C3ETP9312
A0A218VCJ1_9PASEElongation of very long chain fatty acids protein 5Lonchura striata (white-rumped munia)40157UniRef50_Q9NYP7 UniRef100_A0A218VCJ1307
A0A674GXQ5_TAEGUElongation of very long chain fatty acids protein 5Taeniopygia guttata (Zebra finch) (Poephila guttata)59729UniRef50_Q9NYP7 UniRef100_A0A674GXQ5297
A0A7K7II70_LOXCUElongation of very long chain fatty acids protein (Fragment)Loxia curvirostra (Red crossbill)64802UniRef50_Q9NYP7 UniRef100_A0A7K7II70295
A0A7K9G594_LOXLEElongation of very long chain fatty acids protein (Fragment)Loxia leucoptera (White-winged crossbill)96539UniRef100_A0A7K7II70295
A0A674GY01_TAEGUElongation of very long chain fatty acids protein 5Taeniopygia guttata (Zebra finch) (Poephila guttata)59729UniRef50_Q9NYP7 UniRef100_A0A674GY01293
A0A8C3VH24_CATUSElongation of very long chain fatty acids protein 5Catharus ustulatus (Russet-backed thrush) (Hylocichla ustulatus)91951UniRef50_Q9NYP7 UniRef100_A0A8C3VH24293
very long chain fatty acid elongase 5 isoform X1Lonchura striata, …40157UniRef50_Q9NYP7 UniRef100_UPI000B4C9C2D318
elongation of very long chain fatty acids protein 5 isoform X1Sturnus vulgaris, …9172UniRef50_Q9NYP7 UniRef100_UPI00071A7C00309
elongation of very long chain fatty acids protein 5 isoform X2Sturnus vulgaris, …9172UniRef100_UPI00071A7C00295
elongation of very long chain fatty acids protein 5Haemorhous mexicanus, …30427UniRef50_Q9NYP7 UniRef100_UPI0028BDF930295
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
Help