Essential maintenance is planned to begin on Fri Jan 24 2025. The website may be temporarily unavailable. Please use our fallback: https://wwwdev.ebi.ac.uk/uniprot/front-end/fallback/ in case of any outage.

UniRef · UniRef90_A0A1B3W3I0 (90%)

  • Cluster name
    Cytochrome c oxidase subunit 1 (Fragment)
  • Composition
    16 members
  • Last updated
  • Seed
    Built on sequence A0A1B3W3I0
  • Common taxon

Representative

  • Length
    219
  • Mass (Da)
    23,441
  • MD5 Checksum
    2EC0B05AA3A65527E466B4D9165F639A
TLYFIFGAWAGMIGTSLSMLIRAELGHPGALIGNDQIYNVVVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLSLLLTSSLVENGAGTGWTVYPPLSASIAHAGASVDLAIFSLHLAGASSILGAVNFITTVINMRSSGITFDRMPLFVWAVVITAILLLLSLPVLAGAITMLLTDRNFNTSFFDPAGGGDPVLYQHLF

16 members

Expand cluster to 50% identity · List component clusters with 100% identity
Cluster MembersEntry namesProtein namesOrganismsOrganism IDsRelated clustersLengthsRoles
A0A1B3W3I0_9DIPTCytochrome c oxidase subunit 1 (Fragment)Molophilus sp. BOLD-20161886999UniRef50_A0A3Q8TGX4 UniRef100_A0A1B3W3I0219seed & representative
A0A386HW30_9DIPTCytochrome c oxidase subunit 1 (Fragment)Molophilus sp. BARS_2016_41_0742362372UniRef100_A0A1B3W3I0219
A0A2U9JM13_9DIPTCytochrome c oxidase subunit 1 (Fragment)Molophilus sp. BIOUG27163-H112215839UniRef100_A0A1B3W3I0186
A0A165A8C3_9DIPTCytochrome c oxidase subunit 1 (Fragment)Molophilus sp. BOLD:AAZ59671724478UniRef100_A0A1B3W3I0192
A0A2U9JUP1_9DIPTCytochrome c oxidase subunit 1 (Fragment)Molophilus sp. BIOUG20808-A032215858UniRef100_A0A1B3W3I0192
A0A2U9JUQ3_9DIPTCytochrome c oxidase subunit 1 (Fragment)Molophilus sp. BIOUG21705-H052215869UniRef100_A0A1B3W3I0192
A0A0N9HEN6_9DIPTCytochrome c oxidase subunit 1 (Fragment)Molophilus sp. BOLD:AAZ59671724478UniRef100_A0A1B3W3I0203
A0A2Z4EQC1_9DIPTCytochrome c oxidase subunit 1 (Fragment)Molophilus sp. BIOUG20813-B102215820UniRef100_A0A1B3W3I0196
A0A2U9JXP7_9DIPTCytochrome c oxidase subunit 1 (Fragment)Molophilus sp. BIOUG20844-A082215881UniRef100_A0A1B3W3I0196
A0A159VDU2_9DIPTCytochrome c oxidase subunit 1 (Fragment)Molophilus sp. BOLD:AAZ59671724478UniRef100_A0A1B3W3I0196
A0A2Z4EQE4_9DIPTCytochrome c oxidase subunit 1 (Fragment)Molophilus sp. BIOUG20810-D022215819UniRef100_A0A1B3W3I0196
A0A159W0Q6_9DIPTCytochrome c oxidase subunit 1 (Fragment)Chioneinae sp. BOLD:ACL84851822775UniRef50_A0A3Q8TGX4 UniRef100_A0A159W0Q6196
A0A159V8C8_9DIPTCytochrome c oxidase subunit 1 (Fragment)Liogma nodicornis560732UniRef50_A0A3Q8TGX4 UniRef100_A0A159V8C8196
A0A1C9B6E9_9DIPTCytochrome c oxidase subunit 1 (Fragment)Chioneinae sp. BOLD-20161891139UniRef50_A0A3Q8TGX4 UniRef100_A0A1C9B6E9196
A0A2Z4EP76_9DIPTCytochrome c oxidase subunit 1 (Fragment)Chioneinae sp. BIOUG15005-A042213577UniRef100_A0A1C9B6E9196
A0A1C9MT01_9DIPTCytochrome c oxidase subunit 1 (Fragment)Chioneinae sp. BOLD-20161891139UniRef100_A0A1C9B6E9180
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
Help