Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_A0A133V8X6 O-phospho-L-seryl-tRNA:Cys-tRNA synthase n=2 Tax=candidate division MSBL1 TaxID=215777 RepID=A0A133V8X6_9EURY MVEIDLDKYRNLERRVGEDWINIHPIQRGGILPSESRKALLEFANGYSTCDYCLEGRVDL VKKPPILDFAEDVAKFLNMDEARFTPGARGAQRTVFEALTEPGDTVVLDSLAHYTSYLAA EANDLNVKEVPHSGYPEFKIRLDEYADKIEEAKSETGELPALILLTHVDYRYGNLTDSKK VSKIAEEYGVPFVLNAAYTSGVMPVDGKELGVDFLIGSGHKSWAASGPVGILATTYEHAD ETFRTSMIQGSWSGRSFTKKEVYNYGCPPVFGPPIATLMASFPHVVERVERWDEEVEKVR WLVKELEKIEDFHQLGERPRRHTLFSLETPSFHKVSKKRKRRGFFLHEELKERKISGVHP GMTKQIKLNTYGLTKEEIEEVANAFHDIARKYDVKVEE

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A133V8X6A0A133V8X6_9EURYO-phospho-L-seryl-tRNA:Cys-tRNA synthasecandidate division MSBL1 archaeon SCGC-AAA261F191698275UniRef100_A0A133V8X6
398Representative & Seed
A0A133V3F6A0A133V3F6_9EURYCysteine--tRNA ligase (Fragment)candidate division MSBL1 archaeon SCGC-AAA261D191698273UniRef100_A0A133V8X6
162

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A133V8X6

Checksumi: D271A10381A96741

FASTA39845,230
        10         20         30         40         50
MVEIDLDKYR NLERRVGEDW INIHPIQRGG ILPSESRKAL LEFANGYSTC
60 70 80 90 100
DYCLEGRVDL VKKPPILDFA EDVAKFLNMD EARFTPGARG AQRTVFEALT
110 120 130 140 150
EPGDTVVLDS LAHYTSYLAA EANDLNVKEV PHSGYPEFKI RLDEYADKIE
160 170 180 190 200
EAKSETGELP ALILLTHVDY RYGNLTDSKK VSKIAEEYGV PFVLNAAYTS
210 220 230 240 250
GVMPVDGKEL GVDFLIGSGH KSWAASGPVG ILATTYEHAD ETFRTSMIQG
260 270 280 290 300
SWSGRSFTKK EVYNYGCPPV FGPPIATLMA SFPHVVERVE RWDEEVEKVR
310 320 330 340 350
WLVKELEKIE DFHQLGERPR RHTLFSLETP SFHKVSKKRK RRGFFLHEEL
360 370 380 390
KERKISGVHP GMTKQIKLNT YGLTKEEIEE VANAFHDIAR KYDVKVEE
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again