Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q46829 6-phospho-beta-glucosidase BglA n=12001 RepID=BGLA_ECOLI MIVKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVLPGKY YPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMFDE LLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE INNQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINPEMKVGC MLAMVPLYPYSCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGD LDVLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRY ALCELYERYQRPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLM GYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGEKL

Members

List component clusters with 100% or 90% identity.
1 to 25 of 12,001  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q46829BGLA_ECOLI6-phospho-beta-glucosidase BglAEscherichia coli (strain K12)83333UniRef100_Q46829
UniRef90_Q46829
479Representative
P42973BGLA_BACSUAryl-phospho-beta-D-glucosidase BglABacillus subtilis (strain 168)224308UniRef100_P42973
UniRef90_P42973
479
F4NJ15F4NJ15_ECOLX6-phospho-beta-glucosidaseEscherichia coli D9556266UniRef100_Q46829
UniRef90_Q46829
485
W1B5Q8W1B5Q8_KLEPN6-phospho-beta-glucosidaseKlebsiella pneumoniae IS221432547UniRef100_Q46829
UniRef90_Q46829
479
A0A1Q9L4W7A0A1Q9L4W7_ECOLX6-phospho-beta-glucosidaseEscherichia coli562UniRef100_Q46829
UniRef90_Q46829
479
A0A237K069A0A237K069_SHISO6-phospho-beta-glucosidase BglAShigella sonnei624UniRef100_Q46829
UniRef90_Q46829
479
A0A1X3JDF2A0A1X3JDF2_ECOLX6-phospho-beta-glucosidase BglAEscherichia coli H386656397UniRef100_Q46829
UniRef90_Q46829
479
V0A1U2V0A1U2_ECOLX6-phospho-beta-glucosidaseEscherichia coli 909945-21269007UniRef100_Q46829
UniRef90_Q46829
479
I2XAL5I2XAL5_ECOLXGlycosyl hydrolase, family 1Escherichia coli 2.3916869688UniRef100_Q46829
UniRef90_Q46829
479
E3PIH7E3PIH7_ECOH16-phospho-beta-glucosidaseEscherichia coli O78:H11 (strain H10407 / ETEC)316401UniRef100_Q46829
UniRef90_Q46829
479
F4SPH1F4SPH1_ECOLX6-phospho-beta-glucosidase BglAEscherichia coli H736656414UniRef100_Q46829
UniRef90_Q46829
479
A0A2Y0HJ94A0A2Y0HJ94_ECOLX6-phospho-beta-glucosidase bglAEscherichia coli562UniRef100_Q46829
UniRef90_Q46829
304
A0A2S6E2J6A0A2S6E2J6_KLEPN6-phospho-beta-glucosidase (Fragment)Klebsiella pneumoniae573UniRef100_Q46829
UniRef90_Q46829
132
A0A1C2TBF8A0A1C2TBF8_ACIPI6-phospho-beta-glucosidase (Fragment)Acinetobacter pittii (Acinetobacter genomosp. 3)48296UniRef100_Q46829
UniRef90_Q46829
264
G8LDC2G8LDC2_9ENTR6-phospho-beta-glucosidase BglAEnterobacter ludwigii299767UniRef100_G8LDC2
UniRef90_Q46829
498
A0A4R8JRE5A0A4R8JRE5_9ENTR6-phospho-beta-glucosidaseEnterobacteriaceae bacterium NFIX311566306UniRef100_G8LDC2
UniRef90_Q46829
477
W1XGA2W1XGA2_ECOLX6-phospho-beta-glucosidase bglA protein (Fragment)Escherichia coli DORA_A_5_14_211403943UniRef100_G8LDC2
UniRef90_Q46829
37
A0A060C8V0A0A060C8V0_9ESCHCAZy families GH1 protein (Fragment)uncultured Escherichia sp.237777UniRef100_G8LDC2
UniRef90_Q46829
27
W1GZP4W1GZP4_KLEPN6-phospho-beta-glucosidaseKlebsiella pneumoniae ISC211432558UniRef100_W1GZP4
UniRef90_Q46829
497
A0A377U229A0A377U229_KLEPN6-phospho-beta-glucosidaseKlebsiella pneumoniae573UniRef100_W1GZP4
UniRef90_Q46829
239
A0A484XXN6A0A484XXN6_SERLI6-phospho-beta-glucosidase BglASerratia liquefaciens614UniRef100_A0A484XXN6
UniRef90_Q46829
497
A0A377V989A0A377V989_KLEPN6-phospho-beta-glucosidaseKlebsiella pneumoniae573UniRef100_A0A484XXN6
UniRef90_Q46829
72
A0A5C0F119A0A5C0F119_KLEPN6-phospho-beta-glucosidaseKlebsiella pneumoniae573UniRef100_A0A5C0F119
UniRef90_Q46829
485
A0A192CBY2A0A192CBY2_ECOLXBglAEscherichia coli O25b:H4941280UniRef100_A0A192CBY2
UniRef90_Q46829
485
G9Z359G9Z359_9ENTR6-phospho-beta-glucosidaseYokenella regensburgei ATCC 430031002368UniRef100_G9Z359
UniRef90_Q46829
482

Sequence

Representative sequenceiLengthMass (Da)Tools
Q46829

Checksumi: AA493EDAB0E95A56

FASTA47955,361
        10         20         30         40         50
MIVKKLTLPK DFLWGGAVAA HQVEGGWNKG GKGPSICDVL TGGAHGVPRE
60 70 80 90 100
ITKEVLPGKY YPNHEAVDFY GHYKEDIKLF AEMGFKCFRT SIAWTRIFPK
110 120 130 140 150
GDEAQPNEEG LKFYDDMFDE LLKYNIEPVI TLSHFEMPLH LVQQYGSWTN
160 170 180 190 200
RKVVDFFVRF AEVVFERYKH KVKYWMTFNE INNQRNWRAP LFGYCCSGVV
210 220 230 240 250
YTEHENPEET MYQVLHHQFV ASALAVKAAR RINPEMKVGC MLAMVPLYPY
260 270 280 290 300
SCNPDDVMFA QESMRERYVF TDVQLRGYYP SYVLNEWERR GFNIKMEDGD
310 320 330 340 350
LDVLREGTCD YLGFSYYMTN AVKAEGGTGD AISGFEGSVP NPYVKASDWG
360 370 380 390 400
WQIDPVGLRY ALCELYERYQ RPLFIVENGF GAYDKVEEDG SINDDYRIDY
410 420 430 440 450
LRAHIEEMKK AVTYDGVDLM GYTPWGCIDC VSFTTGQYSK RYGFIYVNKH
460 470
DDGTGDMSRS RKKSFNWYKE VIASNGEKL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again