Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P9WQP6 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase n=568 Tax=Bacteria TaxID=2 RepID=3BHS_MYCTO MLRRMGDASLTTELGRVLVTGGAGFVGANLVTTLLDRGHWVRSFDRAPSLLPAHPQLEVL QGDITDADVCAAAVDGIDTIFHTAAIIELMGGASVTDEYRQRSFAVNVGGTENLLHAGQR AGVQRFVYTSSNSVVMGGQNIAGGDETLPYTDRFNDLYTETKVVAERFVLAQNGVDGMLT CAIRPSGIWGNGDQTMFRKLFESVLKGHVKVLVGRKSARLDNSYVHNLIHGFILAAAHLV PDGTAPGQAYFINDAEPINMFEFARPVLEACGQRWPKMRISGPAVRWVMTGWQRLHFRFG FPAPLLEPLAVERLYLDNYFSIAKARRDLGYEPLFTTQQALTECLPYYVSLFEQMKNEAR AEKTAATVKP

Members

List component clusters with 100% or 90% identity.
1 to 25 of 568  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P9WQP63BHS_MYCTO3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomeraseMycobacterium tuberculosis (strain CDC 1551 / Oshkosh)83331UniRef100_P9WQP6
UniRef90_P9WQP6
370Representative
P9WQP73BHS_MYCTU3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomeraseMycobacterium tuberculosis (strain ATCC 25618 / H37Rv)83332UniRef100_P9WQP6
UniRef90_P9WQP6
370
A0A4U7MMD9A0A4U7MMD9_MYCBI3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomeraseMycobacterium bovis1765UniRef100_P9WQP6
UniRef90_P9WQP6
370
A0A045K7Q6A0A045K7Q6_MYCTX3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomeraseMycobacterium tuberculosis1773UniRef100_P9WQP6
UniRef90_P9WQP6
370
A0A328GUT9A0A328GUT9_MYCTX3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomeraseMycobacterium tuberculosis variant pinnipedii194542UniRef100_P9WQP6
UniRef90_P9WQP6
370
R4MBX8R4MBX8_MYCTXCholesterol dehydrogenaseMycobacterium tuberculosis CAS/NITR2041310114UniRef100_P9WQP6
UniRef90_P9WQP6
370
A0A501NYS2A0A501NYS2_9MYCO3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomeraseMycobacterium orygis1305738UniRef100_P9WQP6
UniRef90_P9WQP6
370
A5U1F3A5U1F3_MYCTA3-beta hydroxysteroid dehydrogenase/isomerase family proteinMycobacterium tuberculosis (strain ATCC 25177 / H37Ra)419947UniRef100_P9WQP6
UniRef90_P9WQP6
370
A0A1R3XXD8A0A1R3XXD8_MYCBO3-beta-hydroxysteroid dehydrogenaseMycobacterium bovis (strain ATCC BAA-935 / AF2122/97)233413UniRef100_P9WQP6
UniRef90_P9WQP6
370
A0A0H3M427A0A0H3M427_MYCBPProbable cholesterol dehydrogenaseMycobacterium bovis (strain BCG / Pasteur 1173P2)410289UniRef100_P9WQP6
UniRef90_P9WQP6
370
A0A0Y1C9H5A0A0Y1C9H5_MYCBI3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomeraseMycobacterium tuberculosis variant bovis BCG33892UniRef100_P9WQP6
UniRef90_P9WQP6
370
A0A109SVE5A0A109SVE5_MYCTX3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomeraseMycobacterium tuberculosis variant africanum33894UniRef100_P9WQP6
UniRef90_P9WQP6
370
G0TH00G0TH00_MYCCPPutative cholesterol dehydrogenaseMycobacterium canettii (strain CIPT 140010059)1048245UniRef100_P9WQP6
UniRef90_P9WQP6
370
A0A0H3L7S7A0A0H3L7S7_MYCTECholesterol dehydrogenaseMycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman)652616UniRef100_P9WQP6
UniRef90_P9WQP6
366
A0A1K3N183A0A1K3N183_MYCTXCholesterol dehydrogenaseMycobacterium tuberculosis1773UniRef100_A0A1K3N183
UniRef90_P9WQP6
400
A0A2I7W5L3A0A2I7W5L3_MYCTX3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomeraseMycobacterium tuberculosis1773UniRef100_A0A2I7W5L3
UniRef90_P9WQP6
370
A0A1E3T0I1A0A1E3T0I1_9MYCOSteroid delta-isomeraseMycolicibacillus koreensis1069220UniRef100_A0A1E3T0I1
UniRef90_A0A1E3T0I1
361
A0A1W9ZME7A0A1W9ZME7_9MYCOSteroid delta-isomeraseMycobacterium angelicum470074UniRef100_A0A1W9ZME7
UniRef90_A0A1X2EQ03
371
A0A1X2EQ03A0A1X2EQ03_MYCSZSteroid delta-isomeraseMycobacterium szulgai1787UniRef100_A0A1X2EQ03
UniRef90_A0A1X2EQ03
371
A0A522NHU2A0A522NHU2_9MYCONAD-dependent epimerase/dehydratase family proteinMycobacterium sp.1785UniRef100_A0A522NHU2
UniRef90_A0A522NHU2
370
A0A2U3NV36A0A2U3NV36_9MYCONucleoside-diphosphate-sugar epimeraseMycobacterium sp. AB571841860UniRef100_A0A2U3NV36
UniRef90_A0A2U3NV36
367
A0A1X0GN24A0A1X0GN24_9MYCOSteroid delta-isomeraseMycolicibacterium moriokaense39691UniRef100_A0A1X0GN24
UniRef90_A0A1X0GN24
369
G8RT82G8RT82_MYCRNNucleoside-diphosphate-sugar epimeraseMycolicibacterium rhodesiae (strain NBB3) (Mycobacterium rhodesiae)710685UniRef100_G8RT82
UniRef90_A0A1X0GN24
370
A0A1A2RWY2A0A1A2RWY2_9MYCOSteroid delta-isomeraseMycobacterium sp. E24791834134UniRef100_A0A1A2RWY2
UniRef90_Q73WH2
373
A0A1A3DPT9A0A1A3DPT9_9MYCOSteroid delta-isomeraseMycobacterium sp. 1465703.01834078UniRef100_A0A1A3DPT9
UniRef90_Q73WH2
374

Sequence

Representative sequenceiLengthMass (Da)Tools
P9WQP6

Checksumi: B2A93EC32AFEEA0B

FASTA37040,742
        10         20         30         40         50
MLRRMGDASL TTELGRVLVT GGAGFVGANL VTTLLDRGHW VRSFDRAPSL
60 70 80 90 100
LPAHPQLEVL QGDITDADVC AAAVDGIDTI FHTAAIIELM GGASVTDEYR
110 120 130 140 150
QRSFAVNVGG TENLLHAGQR AGVQRFVYTS SNSVVMGGQN IAGGDETLPY
160 170 180 190 200
TDRFNDLYTE TKVVAERFVL AQNGVDGMLT CAIRPSGIWG NGDQTMFRKL
210 220 230 240 250
FESVLKGHVK VLVGRKSARL DNSYVHNLIH GFILAAAHLV PDGTAPGQAY
260 270 280 290 300
FINDAEPINM FEFARPVLEA CGQRWPKMRI SGPAVRWVMT GWQRLHFRFG
310 320 330 340 350
FPAPLLEPLA VERLYLDNYF SIAKARRDLG YEPLFTTQQA LTECLPYYVS
360 370
LFEQMKNEAR AEKTAATVKP
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again