Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P9WJF8 CRISPR system Cms endoribonuclease Csm3 n=55 Tax=Terrabacteria group TaxID=1783272 RepID=CSM3_MYCTO MTTSYAKIEITGTLTVLTGLQIGAGDGFSAIGAVDKPVVRDPLSRLPMIPGTSLKGKVRT LLSRQYGADTETFYRKPNEDHAHIRRLFGDTEEYMTGRLVFRDTKLTNKDDLEARGAKTL TEVKFENAINRVTAKANLRQMERVIPGSEFAFSLVYEVSFGTPGEEQKASLPSSDEIIED FNAIARGLKLLELDYLGGSGTRGYGQVKFSNLKARAAVGALDGSLLEKLNHELAAV

Members

List component clusters with 100% or 90% identity.
1 to 25 of 55  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P9WJF8CSM3_MYCTOCRISPR system Cms endoribonuclease Csm3Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)83331UniRef100_P9WJF8
UniRef90_P9WJF8
236Representative & Seed
P9WJF9CSM3_MYCTUCRISPR system Cms endoribonuclease Csm3Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)83332UniRef100_P9WJF8
UniRef90_P9WJF8
236
A0A4U7MHR1A0A4U7MHR1_MYCBICRISPR type III-associated RAMP protein Csm3Mycobacterium bovis1765UniRef100_P9WJF8
UniRef90_P9WJF8
236
A0A045JG98A0A045JG98_MYCTXCRISPR type III-associated RAMP protein Csm3Mycobacterium tuberculosis1773UniRef100_P9WJF8
UniRef90_P9WJF8
236
A0A328GCF5A0A328GCF5_MYCTXCRISPR type III-associated RAMP protein Csm3Mycobacterium tuberculosis variant pinnipedii194542UniRef100_P9WJF8
UniRef90_P9WJF8
236
R4MJX3R4MJX3_MYCTXUncharacterized proteinMycobacterium tuberculosis CAS/NITR2041310114UniRef100_P9WJF8
UniRef90_P9WJF8
236
A0A501NW64A0A501NW64_9MYCOCRISPR type III-associated RAMP protein Csm3Mycobacterium orygis1305738UniRef100_P9WJF8
UniRef90_P9WJF8
236
A5U6H4A5U6H4_MYCTAUncharacterized proteinMycobacterium tuberculosis (strain ATCC 25177 / H37Ra)419947UniRef100_P9WJF8
UniRef90_P9WJF8
236
A0A0H3LE22A0A0H3LE22_MYCTEUncharacterized proteinMycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman)652616UniRef100_P9WJF8
UniRef90_P9WJF8
236
A0A1R3Y2C4A0A1R3Y2C4_MYCBOUncharacterized proteinMycobacterium bovis (strain ATCC BAA-935 / AF2122/97)233413UniRef100_P9WJF8
UniRef90_P9WJF8
236
A0A0H3M827A0A0H3M827_MYCBPUncharacterized proteinMycobacterium bovis (strain BCG / Pasteur 1173P2)410289UniRef100_P9WJF8
UniRef90_P9WJF8
236
A0A120J2D2A0A120J2D2_MYCTXCRISPR type III-associated RAMP protein Csm3Mycobacterium tuberculosis variant africanum33894UniRef100_P9WJF8
UniRef90_P9WJF8
236
G0TFC2G0TFC2_MYCCPUncharacterized proteinMycobacterium canettii (strain CIPT 140010059)1048245UniRef100_G0TFC2
UniRef90_P9WJF8
236
UPI00098536BAtype III-A CRISPR-associated RAMP protein Csm3Mycobacterium tuberculosis1773UniRef100_P9WJF8
UniRef90_P9WJF8
235
UPI00099C297Atype III-A CRISPR-associated RAMP protein Csm3Mycobacterium tuberculosis1773UniRef100_P9WJF8
UniRef90_P9WJF8
134
UPI0004F23B75type III-A CRISPR-associated RAMP protein Csm3Mycobacterium tuberculosis1773UniRef100_P9WJF8
UniRef90_P9WJF8
83
UPI00045B6359type III-A CRISPR-associated RAMP protein Csm3Mycobacterium tuberculosis1773UniRef100_P9WJF8
UniRef90_P9WJF8
152
UPI0009A00644type III-A CRISPR-associated RAMP protein Csm3Streptococcus pneumoniae1313UniRef100_P9WJF8
UniRef90_P9WJF8
99
UPI000985B510type III-A CRISPR-associated RAMP protein Csm3Mycobacterium tuberculosis1773UniRef100_P9WJF8
UniRef90_P9WJF8
220
UPI0005DCD8FDtype III-A CRISPR-associated RAMP protein Csm3Mycobacterium tuberculosis1773UniRef100_UPI0005DCD8FD
UniRef90_P9WJF8
236
UPI0005E9CBDFtype III-A CRISPR-associated RAMP protein Csm3Mycobacterium tuberculosis1773UniRef100_UPI0005E9CBDF
UniRef90_P9WJF8
236
UPI0005E948BBtype III-A CRISPR-associated RAMP protein Csm3Mycobacterium tuberculosis1773UniRef100_UPI0005E948BB
UniRef90_P9WJF8
236
UPI00096AA4C7type III-A CRISPR-associated RAMP protein Csm3Mycobacterium tuberculosis1773UniRef100_UPI00096AA4C7
UniRef90_P9WJF8
236
UPI000190174Etype III-A CRISPR-associated RAMP protein Csm3Mycobacterium tuberculosis1773UniRef100_UPI000190174E
UniRef90_P9WJF8
236
UPI0005E0B06Btype III-A CRISPR-associated RAMP protein Csm3Mycobacterium tuberculosis1773UniRef100_UPI0005E0B06B
UniRef90_P9WJF8
236

Sequence

Representative sequenceiLengthMass (Da)Tools
P9WJF8

Checksumi: 1728D20400321017

FASTA23625,773
        10         20         30         40         50
MTTSYAKIEI TGTLTVLTGL QIGAGDGFSA IGAVDKPVVR DPLSRLPMIP
60 70 80 90 100
GTSLKGKVRT LLSRQYGADT ETFYRKPNED HAHIRRLFGD TEEYMTGRLV
110 120 130 140 150
FRDTKLTNKD DLEARGAKTL TEVKFENAIN RVTAKANLRQ MERVIPGSEF
160 170 180 190 200
AFSLVYEVSF GTPGEEQKAS LPSSDEIIED FNAIARGLKL LELDYLGGSG
210 220 230
TRGYGQVKFS NLKARAAVGA LDGSLLEKLN HELAAV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again