Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P21218 Protochlorophyllide reductase B, chloroplastic n=541 Tax=Viridiplantae TaxID=33090 RepID=PORB_ARATH MALQAASLVSSAFSVRKDAKLNASSSSFKDSSLFGASITDQIKSEHGSSSLRFKREQSLR NLAIRAQTAATSSPTVTKSVDGKKTLRKGNVVVTGASSGLGLATAKALAETGKWNVIMAC RDFLKAERAAKSVGMPKDSYTVMHLDLASLDSVRQFVDNFRRTETPLDVLVCNAAVYFPT AKEPTYSAEGFELSVATNHLGHFLLARLLLDDLKKSDYPSKRLIIVGSITGNTNTLAGNV PPKANLGDLRGLAGGLNGLNSSAMIDGGDFDGAKAYKDSKVCNMLTMQEFHRRFHEETGV TFASLYPGCIASTGLFREHIPLFRALFPPFQKYITKGYVSETESGKRLAQVVSDPSLTKS GVYWSWNNASASFENQLSEEASDVEKARKVWEISEKLVGLA

Members

List component clusters with 100% or 90% identity.
1 to 25 of 541  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P21218PORB_ARATHProtochlorophyllide reductase B, chloroplasticArabidopsis thaliana (Mouse-ear cress)3702UniRef100_P21218
UniRef90_P21218
401Representative
O48741PORC_ARATHProtochlorophyllide reductase C, chloroplasticArabidopsis thaliana (Mouse-ear cress)3702UniRef100_O48741
UniRef90_O48741
401
Q39617POR_CHLREProtochlorophyllide reductase, chloroplasticChlamydomonas reinhardtii (Chlamydomonas smithii)3055UniRef100_Q39617
UniRef90_Q39617
397
Q41249PORA_CUCSAProtochlorophyllide reductase, chloroplasticCucumis sativus (Cucumber)3659UniRef100_Q41249
UniRef90_Q41249
398
Q8W3D9PORB_ORYSJProtochlorophyllide reductase B, chloroplasticOryza sativa subsp. japonica (Rice)39947UniRef100_Q8W3D9
UniRef90_Q8W3D9
402
Q01289POR_PEAProtochlorophyllide reductase, chloroplasticPisum sativum (Garden pea)3888UniRef100_Q01289
UniRef90_Q01289
399
Q42850PORB_HORVUProtochlorophyllide reductase B, chloroplasticHordeum vulgare (Barley)4513UniRef100_Q42850
UniRef90_Q42850
395
Q42536PORA_ARATHProtochlorophyllide reductase A, chloroplasticArabidopsis thaliana (Mouse-ear cress)3702UniRef100_Q42536
UniRef90_Q42536
405
O80333POR_MARPAProtochlorophyllide reductase, chloroplasticMarchantia paleacea (Liverwort)56867UniRef100_O80333
UniRef90_O80333
458
P13653PORA_HORVUProtochlorophyllide reductase A, chloroplasticHordeum vulgare (Barley)4513UniRef100_P13653
UniRef90_P13653
388
Q41578PORA_WHEATProtochlorophyllide reductase A, chloroplasticTriticum aestivum (Wheat)4565UniRef100_Q41578
UniRef90_P13653
388
Q9SDT1POR_DAUCAProtochlorophyllide reductase, chloroplasticDaucus carota (Wild carrot)4039UniRef100_Q9SDT1
UniRef90_Q9SDT1
398
A0A178V808A0A178V808_ARATHNADPH-protochlorophyllide oxidoreductaseArabidopsis thaliana (Mouse-ear cress)3702UniRef100_P21218
UniRef90_P21218
401
A0A1J3K376A0A1J3K376_NOCCANADPH-protochlorophyllide oxidoreductase (Fragment)Noccaea caerulescens (Alpine penny-cress) (Thlaspi caerulescens)107243UniRef100_A0A1J3K376
UniRef90_P21218
423
A0A1J3F3J0A0A1J3F3J0_NOCCANADPH-protochlorophyllide oxidoreductase (Fragment)Noccaea caerulescens (Alpine penny-cress) (Thlaspi caerulescens)107243UniRef100_A0A1J3F3J0
UniRef90_P21218
422
A0A565CCL9A0A565CCL9_9BRASNADPH-protochlorophyllide oxidoreductaseArabis nemorensis586526UniRef100_A0A565CCL9
UniRef90_P21218
402
Q570J8Q570J8_ARATHProtochlorophyllide reductase like protein (Fragment)Arabidopsis thaliana (Mouse-ear cress)3702UniRef100_A0A565CCL9
UniRef90_P21218
56
V4MGY4V4MGY4_EUTSANADPH-protochlorophyllide oxidoreductaseEutrema salsugineum (Saltwater cress) (Sisymbrium salsugineum)72664UniRef100_V4MGY4
UniRef90_P21218
402
B6VGD9B6VGD9_CHOBUNADPH-protochlorophyllide oxidoreductaseChorispora bungeana (Blue mustard) (Chorispora exscapa)238895UniRef100_B6VGD9
UniRef90_P21218
402
D7MEF6D7MEF6_ARALLNADPH-protochlorophyllide oxidoreductaseArabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)81972UniRef100_D7MEF6
UniRef90_P21218
401
R0GZY6R0GZY6_9BRASNADPH-protochlorophyllide oxidoreductaseCapsella rubella81985UniRef100_R0GZY6
UniRef90_P21218
398
M4DRA6M4DRA6_BRARPNADPH-protochlorophyllide oxidoreductaseBrassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis)51351UniRef100_M4DRA6
UniRef90_P21218
398
A0A397L260A0A397L260_BRACMNADPH-protochlorophyllide oxidoreductaseBrassica campestris (Field mustard)3711UniRef100_A0A397L260
UniRef90_P21218
398
A0A078GUT8A0A078GUT8_BRANANADPH-protochlorophyllide oxidoreductaseBrassica napus (Rape)3708UniRef100_A0A078GUT8
UniRef90_P21218
397
A0A3P5Z933A0A3P5Z933_BRACMNADPH-protochlorophyllide oxidoreductaseBrassica campestris (Field mustard)3711UniRef100_A0A3P5Z933
UniRef90_P21218
397

Sequence

Representative sequenceiLengthMass (Da)Tools
P21218

Checksumi: 0C2132F980AF6CA3

FASTA40143,359
        10         20         30         40         50
MALQAASLVS SAFSVRKDAK LNASSSSFKD SSLFGASITD QIKSEHGSSS
60 70 80 90 100
LRFKREQSLR NLAIRAQTAA TSSPTVTKSV DGKKTLRKGN VVVTGASSGL
110 120 130 140 150
GLATAKALAE TGKWNVIMAC RDFLKAERAA KSVGMPKDSY TVMHLDLASL
160 170 180 190 200
DSVRQFVDNF RRTETPLDVL VCNAAVYFPT AKEPTYSAEG FELSVATNHL
210 220 230 240 250
GHFLLARLLL DDLKKSDYPS KRLIIVGSIT GNTNTLAGNV PPKANLGDLR
260 270 280 290 300
GLAGGLNGLN SSAMIDGGDF DGAKAYKDSK VCNMLTMQEF HRRFHEETGV
310 320 330 340 350
TFASLYPGCI ASTGLFREHI PLFRALFPPF QKYITKGYVS ETESGKRLAQ
360 370 380 390 400
VVSDPSLTKS GVYWSWNNAS ASFENQLSEE ASDVEKARKV WEISEKLVGL

A
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again