UniRef · UniRef50_P06481 (50%)

  • Cluster name
    Envelope protein US9
  • Composition
    42 members
  • Last updated
  • Seed
    Built on sequence X2FLK7
  • Common taxon

Representative

  • Length
    90
  • Mass (Da)
    10,027
  • Checksum
    F4D4DC2608BB38F7
MTSRLSDPNSSARSDMSVPLYPTASPVSVEAYYSESEDEAANDFLVRMGRQQSVLRRRRRRTRCVGMVIACLLVAVLSGGFGALLMWLLR

42 members

List component clusters with 90% or 100% identity
Cluster MembersEntry namesProtein namesOrganismsOrganism IDsRelated clustersLengthsRoles
US9_HHV11Envelope protein US9Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)10299UniRef90_P06481 UniRef100_P0648190representative
US9_CHV1Envelope protein US9 homologCercopithecine herpesvirus 1 (CeHV-1) (Simian herpes B virus)10325UniRef90_P30025 UniRef100_P3002590
US9_HHV2HEnvelope protein US9Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)10315UniRef90_P89477 UniRef100_P8947789
G8HBI4_HHV11Envelope protein US9Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)10299UniRef90_P06481 UniRef100_P0648190
D3YPD4_HHV1US9Human herpesvirus 1 (HHV-1) (Human herpes simplex virus 1)10298UniRef90_P06481 UniRef100_P0648190
A0A181ZH17_HHV11Envelope protein US9Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)10299UniRef90_P06481 UniRef100_P0648190
I3TCD2_HHV1Type 2 membrane proteinHuman herpesvirus 1 (HHV-1) (Human herpes simplex virus 1)10298UniRef90_P06481 UniRef100_P0648175
E0Z2F9_HHV1Membrane protein US9Human herpesvirus 1 (HHV-1) (Human herpes simplex virus 1)10298UniRef90_P06481 UniRef100_P0648157
U5TQJ2_HHV1Membrane protein US9Human herpesvirus 1 (HHV-1) (Human herpes simplex virus 1)10298UniRef90_P06481 UniRef100_P0648152
A0A140GKI7_HHV1Truncated membrane protein US9Human herpesvirus 1 (HHV-1) (Human herpes simplex virus 1)10298UniRef90_P06481 UniRef100_P0648151
G8H8I8_HHV1US9Human herpesvirus 1 (HHV-1) (Human herpes simplex virus 1)10298UniRef90_P06481 UniRef100_G8H8I890
A0A1C3J7S0_HHV1US9Human herpesvirus 1 (HHV-1) (Human herpes simplex virus 1)10298UniRef90_P06481 UniRef100_A0A1C3J7S090
L0N4F5_HHV1Membrane protein US9Human alphaherpesvirus 1 strain RH2946522UniRef90_P06481 UniRef100_A0A1C3J7S090
D3YPM8_HHV1Membrane protein US9Human herpesvirus 1 (HHV-1) (Human herpes simplex virus 1)10298UniRef90_P06481 UniRef100_D3YPM890
A0A181ZIF4_HHV11Envelope protein US9Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)10299UniRef90_P06481 UniRef100_A0A181ZIF490
F8REK3_HHV1US9Human herpesvirus 1 (HHV-1) (Human herpes simplex virus 1)10298UniRef90_P06481 UniRef100_A0A181ZIF490
A0A0B5EAS0_HHV1US9Human herpesvirus 1 (HHV-1) (Human herpes simplex virus 1)10298UniRef90_P06481 UniRef100_A0A0B5EAS090
A0A181ZHE5_HHV11Envelope protein US9Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)10299UniRef90_P06481 UniRef100_A0A181ZHE590
A0A6B9XM86_HHV1Membrane protein US9Human herpesvirus 1 (HHV-1) (Human herpes simplex virus 1)10298UniRef90_P06481 UniRef100_A0A6B9XM8690
Q69372_9ALPHEnvelope phosphoproteinCercopithecine alphaherpesvirus 210317UniRef90_Q69372 UniRef100_Q6937291
X2FLK7_CHV16Membrane protein US9Cercopithecine herpesvirus 16 (CeHV-16) (Herpesvirus papio 2)340907UniRef90_Q5Y0N3 UniRef100_X2FLK791seed
Q5Y0N3_9ALPHTegument proteinCercopithecine alphaherpesvirus 210317UniRef90_Q5Y0N3 UniRef100_Q5Y0N391
Q2HWW7_CHV16Membrane protein US9Cercopithecine herpesvirus 16 (CeHV-16) (Herpesvirus papio 2)340907UniRef90_Q5Y0N3 UniRef100_Q2HWW791
Q2QBA7_CHV16US9Cercopithecine herpesvirus 16 (CeHV-16) (Herpesvirus papio 2)340907UniRef90_Q5Y0N3 UniRef100_Q2QBA791
A0A1X9WFX4_CHV1Membrane protein US9Cercopithecine herpesvirus 1 (CeHV-1) (Simian herpes B virus)10325UniRef90_P30025 UniRef100_A0A1X9WFX490
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp