UniRef · UniRef50_P03929 (50%)

  • Cluster name
    ATP synthase protein 8
  • Composition
    2,750 members
  • Last updated
  • Seed
    Built on sequence A0A0B4VKE1
  • Common taxon
    Top level (root)

Representative

  • Length
    66
  • Mass (Da)
    7,937
  • Checksum
    0DED46ADEF5D8BDE
MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL

2,750 members

List component clusters with 90% or 100% identity
Cluster MembersEntry namesProtein namesOrganismsOrganism IDsRelated clustersLengthsRoles
ATP8_BOVINATP synthase protein 8Bos taurus (Bovine)9913UniRef90_P03929 UniRef100_P0392966representative
ATP8_BOSINATP synthase protein 8Bos indicus (Zebu)9915UniRef90_P03929 UniRef100_Q6EMS766
ATP8_CERSIATP synthase protein 8Ceratotherium simum (White rhinoceros) (Square-lipped rhinoceros)9807UniRef90_O03199 UniRef100_O0319968
ATP8_RATATP synthase protein 8Rattus norvegicus (Rat)10116UniRef90_P11608 UniRef100_P1160867
ATP8_FELCAATP synthase protein 8Felis catus (Cat) (Felis silvestris catus)9685UniRef90_P48896 UniRef100_P4889667
ATP8_CAPHIATP synthase protein 8Capra hircus (Goat)9925UniRef90_Q32643 UniRef100_Q3264365
ATP8_CAPIIATP synthase protein 8Capra ibex ibex (Alpine ibex)80420UniRef90_Q32643 UniRef100_Q9MQK265
ATP8_EQUASATP synthase protein 8Equus asinus (Donkey) (Equus africanus asinus)9793UniRef90_P48663 UniRef100_P9247967
ATP8_HORSEATP synthase protein 8Equus caballus (Horse)9796UniRef90_P48663 UniRef100_P4866367
ATP8_AILFUATP synthase protein 8Ailurus fulgens (Himalayan red panda)9649UniRef90_Q3L6W9 UniRef100_Q3L6W967
ATP8_SHEEPATP synthase protein 8Ovis aries (Sheep)9940UniRef90_O78751 UniRef100_O7875166
ATP8_PHYMCATP synthase protein 8Physeter macrocephalus (Sperm whale) (Physeter catodon)9755UniRef90_Q9MET2 UniRef100_Q9MET263
ATP8_CANLFATP synthase protein 8Canis lupus familiaris (Dog) (Canis familiaris)9615UniRef90_Q9ZZ63 UniRef100_Q9ZZ6367
ATP8_CANLUATP synthase protein 8Canis lupus (Gray wolf)9612UniRef90_Q9ZZ63 UniRef100_Q9ZZ6367
ATP8_RABITATP synthase protein 8Oryctolagus cuniculus (Rabbit)9986UniRef90_O79431 UniRef100_O7943167
ATP8_HIPAMATP synthase protein 8Hippopotamus amphibius (Hippopotamus)9833UniRef90_Q9ZZY7 UniRef100_Q9ZZY768
ATP8_CRIGRATP synthase protein 8Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)10029UniRef90_P14414 UniRef100_P1441467
ATP8_PHOVIATP synthase protein 8Phoca vitulina (Harbor seal)9720UniRef90_Q00522 UniRef100_Q0052267
ATP8_HALGRATP synthase protein 8Halichoerus grypus (Gray seal) (Phoca grypus)9711UniRef90_Q00522 UniRef100_P3859267
ATP8_MICPEATP synthase protein 8Microtus pennsylvanicus (Meadow vole)10058UniRef90_P24949 UniRef100_P2494967
ATP8_FELSLATP synthase protein 8Felis silvestris lybica (African wildcat) (Felis lybica)61377UniRef90_Q94NW9 UniRef100_Q94NW967
ATP8_ORNANATP synthase protein 8Ornithorhynchus anatinus (Duckbill platypus)9258UniRef90_Q36453 UniRef100_Q3645369
ATP8_TALEUATP synthase protein 8Talpa europaea (European mole)9375UniRef90_Q9MJB2 UniRef100_Q9MJB267
ATP8_PIGATP synthase protein 8Sus scrofa (Pig)9823UniRef90_Q35914 UniRef100_Q3591467
ATP8_LEMCAATP synthase protein 8Lemur catta (Ring-tailed lemur)9447UniRef90_Q8LX28 UniRef100_Q8LX2868
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp