UniRef · UniRef100_Q9BYJ9-2 (100%)
- Cluster nameIsoform 2 of YTH domain-containing family protein 1
- Last updated
- SeedBuilt on sequence Q9BYJ9-2
- Common taxon
Representative
- Length197
- Mass (Da)20,833
- ChecksumDD50829544FE6119
MLFLGSLGAWGTTSISTGSIFSLKTLRSQHGGQVGLKVSRPRAPRMGAATPTPRAPWVARWLMGSQAFTATPSARPPPPIKHNMDIGTWDNKGPVPKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNSPGNVQPNSAPSVESHPVLEKLKAAHSYNPKEF
1 member
Cluster Members | Entry names | Protein names | Organisms | Organism IDs | Related clusters | Lengths | Roles | ||
---|---|---|---|---|---|---|---|---|---|
Q9BYJ9-2 | Isoform 2 of YTH domain-containing family protein 1 | Homo sapiens (Human) | 9606 | UniRef50_Q9BYJ9-2 UniRef90_Q9BYJ9-2 | 197 | seed & representative |