UniRef · UniRef100_Q8C6G1 (100%)
- Cluster nameCilia- and flagella-associated protein 410
- Last updated
- SeedBuilt on sequence Q8C6G1
- Common taxon
Representative
- Length249
- Mass (Da)28,239
- ChecksumF3B26A152BFB1819
MKLTRKMVLSRAKASELHNVRKLNCWGSQLTDISICREMPSLEVITLSVNSVSTLEPVRSCRRLSELYLRRNRIPSLNELFYLKDLPHLRVLWLAENPCCGTSPHLYRMTVLRNLPHLQKLDNQAVTEEELTRALMEGDEITAAPHREGAGNGCPKPPYALNSVSSATETSQHLLSYTEETEVQGQTTTDQSPSFSPRDTMRSHKNRNILTAILLLLRELDTEGLETVQQTVGSRLQALHRPEPQEDME
2 members
Cluster Members | Entry names | Protein names | Organisms | Organism IDs | Related clusters | Lengths | Roles | ||
---|---|---|---|---|---|---|---|---|---|
CF410_MOUSE | Cilia- and flagella-associated protein 410 | Mus musculus (Mouse) | 10090 | UniRef50_O43822 UniRef90_Q8C6G1 | 249 | seed & representative | |||
cilia- and flagella-associated protein 410 isoform X3 | Mus musculus | 10090 | UniRef90_Q8C6G1 | 211 |