UniRef · UniRef100_Q72PK5 (100%)

  • Cluster name
    Carbamoyl phosphate synthase small chain
  • Composition
    8 members
  • Last updated
  • Seed
    Built on sequence Q72PK5

Representative

  • Length
    363
  • Mass (Da)
    40,262
  • Checksum
    A6172FF65E3A10FF
MMKAFLVLDNGTIFEGESFGYETESVGEIVFNTSMAGYQEILTDPSYCNQIITLTYPMIGNYGIHPDNMESSKIQASGLIVKEYVDLPSNFKSEKTLSQFLKEYKIPAIQGIDTRKLTRFIRTNGSPNGGIFVASEYSPSFLEKVKSFPGIINADLAEVVTTSSKYIFGTHTGKKFKLAVYDYGVKTNILRLLDANGFAVTVYPAKTPSEEIMKEGTDAFFLSNGPGDPAPLDYAIASTQKIMEKRYPLFGICLGHQIIGLSLGKKTEKMKFGHRGGNQPVKNLETGQVEITSQNHGFAVIDDQKQDEPISFLNLNDHTVEGILKSGYPLLTVQYHPESAPGPNDSRYLFQKFYDLVEKTKKG

8 members

Expand cluster to 50% or 90% identity
Cluster MembersEntry namesProtein namesOrganismsOrganism IDsRelated clustersLengthsRoles
CARA_LEPICCarbamoyl phosphate synthase small chainLeptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni(strain Fiocruz L1-130)267671UniRef50_Q8F6R2 UniRef90_Q8F6R2 363seed & representative
A0AAW4K0C5_LEPIRGlutamine-hydrolyzing carbamoyl-phosphate synthase small subunitLeptospira interrogans serovar Icterohaemorrhagiae90062UniRef90_Q8F6R2 362
M3H334_LEPIRCarbamoyl-phosphate synthase pyrimidine-specific small chain domain proteinLeptospira interrogans serovar Grippotyphosa str. LT21861001599UniRef90_Q8F6R2 94
M6KUY4_LEPIRCarbamoyl-phosphate synthase pyrimidine-specific small chain domain proteinLeptospira interrogans serovar Pyrogenes str. L03741049928UniRef90_Q8F6R2 94
M3CLM8_LEPIRCarbamoyl-phosphate synthase pyrimidine-specific small chain domain proteinLeptospira interrogans serovar Lora str. TE 19921193028UniRef90_Q8F6R2 94
glutamine-hydrolyzing carbamoyl-phosphate synthase small subunitLeptospira interrogans, …173UniRef90_Q8F6R2 279
carbamoyl phosphate synthase small subunitLeptospira interrogans, …173UniRef90_Q8F6R2 242
glutamine-hydrolyzing carbamoyl-phosphate synthase small subunitLeptospira interrogans, …173UniRef90_Q8F6R2 263
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp