UniRef · UniRef100_Q6PER3 (100%)

  • Cluster name
    Microtubule-associated protein RP/EB family member 3
  • Composition
    10 members
  • Last updated
  • Seed
    Built on sequence UPI000A315621
  • Common taxon

Representative

  • Length
    281
  • Mass (Da)
    31,966
  • Checksum
    6713427C480838DC
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHEADAQILELNQQLLDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY

10 members

Expand cluster to 50% or 90% identity
Cluster MembersEntry namesProtein namesOrganismsOrganism IDsRelated clustersLengthsRoles
MARE3_MOUSEMicrotubule-associated protein RP/EB family member 3Mus musculus (Mouse)10090UniRef50_Q9UPY8 UniRef90_Q9UPY8 281representative
MARE3_RATMicrotubule-associated protein RP/EB family member 3Rattus norvegicus (Rat)10116UniRef90_Q9UPY8 281
A0A643CHV6_BALPHMicrotubule-associated protein RP/EB family member 3 (Fragment)Balaenoptera physalus (Fin whale) (Balaena physalus)9770UniRef90_Q9UPY8 282
A0A340YCZ4_LIPVEMicrotubule-associated protein RP/EB family member 3 isoform X2Lipotes vexillifer (Yangtze river dolphin)118797UniRef90_Q9UPY8 281
A0A8J6AKE2_GALPYMicrotubule-associated protein RP/EB family member 3Galemys pyrenaicus (Iberian desman) (Pyrenean desman)202257UniRef90_Q9UPY8 281
G3GXR7_CRIGRMicrotubule-associated protein RP/EB family member 3Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)10029UniRef90_Q9UPY8 281
A0A6P5PXC0_MUSCRMicrotubule-associated protein RP/EB family member 3 isoform X1Mus caroli (Ryukyu mouse) (Ricefield mouse)10089UniRef90_Q9UPY8 281
A0AAU9Z2T6_PHOROMapre3 proteinPhodopus roborovskii (Roborovski's desert hamster) (Cricetulusroborovskii)109678UniRef90_Q9UPY8 281
Q2UZW7_MOUSEMicrotubule-associated proteinMus musculus (Mouse)10090UniRef90_Q9UPY8 281
microtubule-associated protein RP/EB family member 3 isoform X1Phodopus roborovskii, …109678UniRef90_Q9UPY8 287seed
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp