Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_P9WJU4 Sulfolipid-1 exporter MmpL8 n=15 Tax=Bacteria TaxID=2 RepID=MMPL8_MYCTO MCDVLMQPVRTPRPSTNLRSKPLRPTGDGGVFPRLGRLIVRRPWVVIAFWVALAGLLAPT VPSLDAISQRHPVAILPSDAPVLVSTRQMTAAFREAGLQSVAVVVLSDAKGLGAADERSY KELVDALRRDTRDVVMLQDFVTTPPLRELMTSKDNQAWILPVGLPGDLGSTQSKQAYARV ADIVEHQVAGSTLTANLTGPAATVADLNLTGQRDRSRIEFAITILLLVILLIIYGNPITM VLPLITIGMSVVVAQRLVAIAGLAGLGIANQSIIFMSGMMVGAGTDYAVFLISRYHDYLR QGADSDQAVKKALTSIGKVIAASAATVAITFLGMVFTQLGILKTVGPMLGISVAVVFFAA VTLLPALMVLTGRRGWIAPRRDLTRRFWRSSGVHIVRRPKTHLLASALVLVILAGCAGLA RYNYDDRKTLPASVESSIGYAALDKHFPSNLIIPEYLFIQSSTDLRTPKALADLEQMVQR VSQVPGVAMVRGITRPAGRSLEQARTSWQAGEVGSKLDEGSKQIAVHTGDIDKLAGGANL MASKLGDVRAQVNRAISTVGGLIDALAYLQDLLGGNRVLGELEGAEKLIGSMRALGDTID ADASFVANNTEWASPVLGALDSSPMCTADPACASARTELQRLVTARDDGTLAKISELARQ LQATRAVQTLAATVSGLRGALATVIRAMGSLGMSSPGGVRSKINLVNKGVNDLADGSRQL AEGVQLLVDQVKKMGFGLGEASAFLLAMKDTATTPAMAGFYIPPELLSYATGESVKAETM PSEYRDLLGGLNVDQLKKVAAAFISPDGHSIRYLIQTDLNPFSTAAMDQIDAITAAARGA QPNTALADAKVSVVGLPVVLKDTRDYSDHDLRLIIAMTVCIVLLILIVLLRAIVAPLYLI GSVIVSYLAALGIGVIVFQFLLGQEMHWSIPGLTFVILVAVGADYNMLLISRLREEAVLG VRSGVIRTVASTGGVITAAGLIMAASMYGLVFASLGSVVQGAFVLGTGLLLDTFLVRTVT VPAIAVLVGQANWWLPSSWRPATWWPLGRRRGRAQRTKRKPLLPKEEEEQSPPDDDDLIG LWLHDGLRL

Members

Expand cluster to 90% or 50% identity.
1 to 15 of 15  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P9WJU4MMPL8_MYCTOSulfolipid-1 exporter MmpL8Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)833311,089Representative
A5U9F2MMPL8_MYCTAProbable transport protein MmpL8Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)4199471,089Seed
P9WJU5MMPL8_MYCTUSulfolipid-1 exporter MmpL8Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)833321,089
A0A045ILW7A0A045ILW7_MYCTXSulfolipid-1 RND transporter MmpL8Mycobacterium tuberculosis17731,089
R4MPB7R4MPB7_MYCTXMembrane transporter mmpL8Mycobacterium tuberculosis CAS/NITR20413101141,089
A0A2N7VCM4A0A2N7VCM4_9BURKMMPL family RND transporter (Fragment)Paraburkholderia rhynchosiae487049135
UPI000E2F6FB4sulfolipid-1 RND transporter MmpL8Mycobacterium tuberculosis17731,086
UPI000B41DA9Bsulfolipid-1 RND transporter MmpL8Mycobacterium tuberculosis17731,078
UPI00045A17C2sulfolipid-1 RND transporter MmpL8Mycobacterium tuberculosis17731,075
UPI0006970FC4sulfolipid-1 RND transporter MmpL8Mycobacterium tuberculosis17731,031
UPI0005DF31BCsulfolipid-1 RND transporter MmpL8Mycobacterium tuberculosis1773980
UPI0004F24964sulfolipid-1 RND transporter MmpL8Mycobacterium tuberculosis1773738
UPI000696A0C7sulfolipid-1 RND transporter MmpL8Mycobacterium tuberculosis1773838
UPI000E22710Dsulfolipid-1 RND transporter MmpL8Mycobacterium tuberculosis1773809
UPI00070E36FCsulfolipid-1 RND transporter MmpL8Mycobacterium tuberculosis1773872

Sequence

Representative sequenceiLengthMass (Da)Tools
P9WJU4

Checksumi: E9F842026831060F

FASTA1,089115,998
        10         20         30         40         50
MCDVLMQPVR TPRPSTNLRS KPLRPTGDGG VFPRLGRLIV RRPWVVIAFW
60 70 80 90 100
VALAGLLAPT VPSLDAISQR HPVAILPSDA PVLVSTRQMT AAFREAGLQS
110 120 130 140 150
VAVVVLSDAK GLGAADERSY KELVDALRRD TRDVVMLQDF VTTPPLRELM
160 170 180 190 200
TSKDNQAWIL PVGLPGDLGS TQSKQAYARV ADIVEHQVAG STLTANLTGP
210 220 230 240 250
AATVADLNLT GQRDRSRIEF AITILLLVIL LIIYGNPITM VLPLITIGMS
260 270 280 290 300
VVVAQRLVAI AGLAGLGIAN QSIIFMSGMM VGAGTDYAVF LISRYHDYLR
310 320 330 340 350
QGADSDQAVK KALTSIGKVI AASAATVAIT FLGMVFTQLG ILKTVGPMLG
360 370 380 390 400
ISVAVVFFAA VTLLPALMVL TGRRGWIAPR RDLTRRFWRS SGVHIVRRPK
410 420 430 440 450
THLLASALVL VILAGCAGLA RYNYDDRKTL PASVESSIGY AALDKHFPSN
460 470 480 490 500
LIIPEYLFIQ SSTDLRTPKA LADLEQMVQR VSQVPGVAMV RGITRPAGRS
510 520 530 540 550
LEQARTSWQA GEVGSKLDEG SKQIAVHTGD IDKLAGGANL MASKLGDVRA
560 570 580 590 600
QVNRAISTVG GLIDALAYLQ DLLGGNRVLG ELEGAEKLIG SMRALGDTID
610 620 630 640 650
ADASFVANNT EWASPVLGAL DSSPMCTADP ACASARTELQ RLVTARDDGT
660 670 680 690 700
LAKISELARQ LQATRAVQTL AATVSGLRGA LATVIRAMGS LGMSSPGGVR
710 720 730 740 750
SKINLVNKGV NDLADGSRQL AEGVQLLVDQ VKKMGFGLGE ASAFLLAMKD
760 770 780 790 800
TATTPAMAGF YIPPELLSYA TGESVKAETM PSEYRDLLGG LNVDQLKKVA
810 820 830 840 850
AAFISPDGHS IRYLIQTDLN PFSTAAMDQI DAITAAARGA QPNTALADAK
860 870 880 890 900
VSVVGLPVVL KDTRDYSDHD LRLIIAMTVC IVLLILIVLL RAIVAPLYLI
910 920 930 940 950
GSVIVSYLAA LGIGVIVFQF LLGQEMHWSI PGLTFVILVA VGADYNMLLI
960 970 980 990 1000
SRLREEAVLG VRSGVIRTVA STGGVITAAG LIMAASMYGL VFASLGSVVQ
1010 1020 1030 1040 1050
GAFVLGTGLL LDTFLVRTVT VPAIAVLVGQ ANWWLPSSWR PATWWPLGRR
1060 1070 1080
RGRAQRTKRK PLLPKEEEEQ SPPDDDDLIG LWLHDGLRL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again