Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_P9WFK2 UPF0336 protein MT0525.1 n=19 Tax=Mycobacterium tuberculosis complex TaxID=77643 RepID=Y504_MYCTO MTVPEEAQTLIGKHYRAPDHFLVGREKIREFAVAVKDDHPTHYSEPDAAAAGYPALVAPL TFLAIAGRRVQLEIFTKFNIPINIARVFHRDQKFRFHRPILANDKLYFDTYLDSVIESHG TVLAEIRSEVTDAEGKPVVTSVVTMLGEAAHHEADADATVAAIASI

Members

Expand cluster to 90% or 50% identity.
1 to 19 of 19  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P9WFK2Y504_MYCTOUPF0336 protein MT0525.1Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)83331166Representative & Seed
P9WFK3Y504_MYCTUUPF0336 protein Rv0504cMycobacterium tuberculosis (strain ATCC 25618 / H37Rv)83332166
P64726Y516_MYCBOUPF0336 protein Mb0516cMycobacterium bovis (strain ATCC BAA-935 / AF2122/97)233413166
A0A4U7MQG7A0A4U7MQG7_MYCBIUPF0336 protein B7493_00905Mycobacterium bovis1765166
A0A045IW08A0A045IW08_MYCTXUPF0336 protein DSI35_10450Mycobacterium tuberculosis1773166
A0A328GWU2A0A328GWU2_MYCTXUPF0336 protein C9J59_002935Mycobacterium tuberculosis variant pinnipedii194542166
A0A501P2Y2A0A501P2Y2_9MYCOUPF0336 protein FHI80_08810Mycobacterium orygis1305738166
A5TZN4A5TZN4_MYCTAUPF0336 protein MRA_0512Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)419947166
A0A0H3L5S8A0A0H3L5S8_MYCTEUPF0336 protein ERDMAN_0553Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman)652616166
A0A0H3M3S6A0A0H3M3S6_MYCBPUPF0336 protein BCG_0547cMycobacterium bovis (strain BCG / Pasteur 1173P2)410289166
A0A0K2HT44A0A0K2HT44_MYCBIUPF0336 protein RN06_0620Mycobacterium tuberculosis variant bovis BCG33892166
A0A120IZQ8A0A120IZQ8_MYCTXUPF0336 protein RN09_0617Mycobacterium tuberculosis variant africanum33894166
G0TPL4G0TPL4_MYCCPUPF0336 protein MCAN_05071Mycobacterium canettii (strain CIPT 140010059)1048245166
UPI00067E2CC6hypothetical proteinMycobacterium tuberculosis1773162
UPI00067C87DEhypothetical proteinMycobacterium tuberculosis1773156
UPI00045B9546hypothetical proteinMycobacterium tuberculosis1773140
UPI000365A9FFhypothetical proteinMycobacterium tuberculosis1773114
UPI000E2ED6D1hypothetical proteinMycobacterium tuberculosis1773114
UPI00093006B0hypothetical proteinMycobacterium tuberculosis1773137

Sequence

Representative sequenceiLengthMass (Da)Tools
P9WFK2

Checksumi: 9831263632CC1DCC

FASTA16618,360
        10         20         30         40         50
MTVPEEAQTL IGKHYRAPDH FLVGREKIRE FAVAVKDDHP THYSEPDAAA
60 70 80 90 100
AGYPALVAPL TFLAIAGRRV QLEIFTKFNI PINIARVFHR DQKFRFHRPI
110 120 130 140 150
LANDKLYFDT YLDSVIESHG TVLAEIRSEV TDAEGKPVVT SVVTMLGEAA
160
HHEADADATV AAIASI
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again