Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_P0A541 Deoxyguanosinetriphosphate triphosphohydrolase-like protein n=37 Tax=Bacteria TaxID=2 RepID=DGTL1_MYCBO MSASEHDPYDDFDRQRRVAEAPKTAGLPGTEGQYRSDFARDRARVLHSAALRRLADKTQV VGPREGDTPRTRLTHSLEVAQIGRGMAIGLGCDLDLVELAGLAHDIGHPPYGHNGERALD EVAASHGGFEGNAQNFRILTSLEPKVVDAQGLSAGLNLTRASLDAVTKYPWMRGDGLGSQ RRKFGFYDDDRESAVWVRQGAPPERACLEAQVMDWADDVAYSVHDVEDGVVSERIDLRVL AAEEDAAALARLGEREFSRVSADELMAAARRLSRLPVVAAVGKYDATLSASVALKRLTSE LVGRFASAAIATTRAAAGPGPLVRFRADLQVPDLVRAEVAVLKILALQFIMSDPRHLETQ ARQRERIHRVAHRLYSGAPQTLDPVYAAAFNTAADDAARLRVVVDQIASYTEGRLERIDA DQLGVSRNALD

Members

Expand cluster to 90% or 50% identity.
1 to 25 of 37  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P0A541DGTL1_MYCBODeoxyguanosinetriphosphate triphosphohydrolase-like proteinMycobacterium bovis (strain ATCC BAA-935 / AF2122/97)233413431Representative & Seed
A1KL43DGTL1_MYCBPDeoxyguanosinetriphosphate triphosphohydrolase-like proteinMycobacterium bovis (strain BCG / Pasteur 1173P2)410289431
A5U533DGTL1_MYCTADeoxyguanosinetriphosphate triphosphohydrolase-like proteinMycobacterium tuberculosis (strain ATCC 25177 / H37Ra)419947431
P9WNY7DGTL1_MYCTUDeoxyguanosinetriphosphate triphosphohydrolase-like proteinMycobacterium tuberculosis (strain ATCC 25618 / H37Rv)83332431
A0A4U7MRM7A0A4U7MRM7_MYCBIDeoxyguanosinetriphosphate triphosphohydrolase-like proteinMycobacterium bovis1765431
A0A045J208A0A045J208_MYCTXDeoxyguanosinetriphosphate triphosphohydrolase-like proteinMycobacterium tuberculosis1773431
A0A328GG38A0A328GG38_MYCTXDeoxyguanosinetriphosphate triphosphohydrolase-like proteinMycobacterium tuberculosis variant pinnipedii194542431
A0A0H3LBE1A0A0H3LBE1_MYCTEDeoxyguanosinetriphosphate triphosphohydrolase-like proteinMycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman)652616431
G0TNQ2G0TNQ2_MYCCPDeoxyguanosinetriphosphate triphosphohydrolase-like proteinMycobacterium canettii (strain CIPT 140010059)1048245431
A0A120IPF4A0A120IPF4_MYCBIDeoxyguanosine triphosphate triphosphohydrolaseMycobacterium tuberculosis variant bovis BCG33892155
UPI0006966DABdeoxyguanosinetriphosphate triphosphohydrolaseMycobacterium tuberculosis1773427
UPI0007EB4A9Edeoxyguanosinetriphosphate triphosphohydrolaseMycobacterium tuberculosis1773424
UPI0005C5CC8Ddeoxyguanosinetriphosphate triphosphohydrolaseMycobacterium tuberculosis1773418
UPI000E2FC3A3deoxyguanosinetriphosphate triphosphohydrolaseMycobacterium tuberculosis1773404
UPI001092553Ddeoxyguanosinetriphosphate triphosphohydrolaseMycobacterium tuberculosis1773398
UPI000E2EBC8Ddeoxyguanosinetriphosphate triphosphohydrolaseMycobacterium tuberculosis1773247
UPI0006B4F494deoxyguanosinetriphosphate triphosphohydrolaseMycobacterium tuberculosis1773366
UPI000E2F2739deoxyguanosinetriphosphate triphosphohydrolaseMycobacterium tuberculosis1773362
UPI000E31B551deoxyguanosinetriphosphate triphosphohydrolaseMycobacterium tuberculosis1773254
UPI000E2F8F17deoxyguanosinetriphosphate triphosphohydrolaseMycobacterium tuberculosis1773348
UPI000E2F21D6deoxyguanosinetriphosphate triphosphohydrolaseMycobacterium tuberculosis1773250
UPI000E2FCA22deoxyguanosinetriphosphate triphosphohydrolaseMycobacterium tuberculosis1773374
UPI000ADFDDDFdeoxyguanosinetriphosphate triphosphohydrolaseMycobacterium tuberculosis1773266
UPI000E2F543Ddeoxyguanosinetriphosphate triphosphohydrolaseMycobacterium tuberculosis1773321
UPI000E2FEE18deoxyguanosinetriphosphate triphosphohydrolaseMycobacterium tuberculosis1773376

Sequence

Representative sequenceiLengthMass (Da)Tools
P0A541

Checksumi: 75796A692301B0A2

FASTA43146,912
        10         20         30         40         50
MSASEHDPYD DFDRQRRVAE APKTAGLPGT EGQYRSDFAR DRARVLHSAA
60 70 80 90 100
LRRLADKTQV VGPREGDTPR TRLTHSLEVA QIGRGMAIGL GCDLDLVELA
110 120 130 140 150
GLAHDIGHPP YGHNGERALD EVAASHGGFE GNAQNFRILT SLEPKVVDAQ
160 170 180 190 200
GLSAGLNLTR ASLDAVTKYP WMRGDGLGSQ RRKFGFYDDD RESAVWVRQG
210 220 230 240 250
APPERACLEA QVMDWADDVA YSVHDVEDGV VSERIDLRVL AAEEDAAALA
260 270 280 290 300
RLGEREFSRV SADELMAAAR RLSRLPVVAA VGKYDATLSA SVALKRLTSE
310 320 330 340 350
LVGRFASAAI ATTRAAAGPG PLVRFRADLQ VPDLVRAEVA VLKILALQFI
360 370 380 390 400
MSDPRHLETQ ARQRERIHRV AHRLYSGAPQ TLDPVYAAAF NTAADDAARL
410 420 430
RVVVDQIASY TEGRLERIDA DQLGVSRNAL D
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again