Essential maintenance is planned to begin on Fri Jan 24 2025. The website may be temporarily unavailable. Please use our fallback: https://wwwdev.ebi.ac.uk/uniprot/front-end/fallback/ in case of any outage.

UniRef · UniRef100_E5RGG8 (100%)

  • Cluster name
    Sodium-dependent phosphate transporter 2
  • Composition
    9 members
  • Last updated
  • Seed
    Built on sequence A0A8B9XQL0
  • Common taxon

Representative

  • Length
    78
  • Mass (Da)
    8,169
  • MD5 Checksum
    FE5E6709E6C42E5EF5BDA48208F6754E
MAMDEYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSVLLGAKVGETIRKGIIDVN

9 members

Expand cluster to 50% or 90% identity
Cluster MembersEntry namesProtein namesOrganismsOrganism IDsRelated clustersLengthsRoles
E5RGG8_HUMANSodium-dependent phosphate transporter 2Homo sapiens (Human)9606UniRef50_Q08357 UniRef90_E5RGG8 78representative
E5RGJ6_HUMANSodium-dependent phosphate transporter 2Homo sapiens (Human)9606UniRef90_E5RGG8 70
A0A8B9XQL0_BOSMUPhosphate transporterBos mutus grunniens (Wild yak) (Bos grunniens)30521UniRef90_E5RGG8 741seed
A0A2J8N773_PANTRSodium-dependent phosphate transporter 2 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef90_E5RGG8 71
E5RJW9_HUMANSolute carrier family 20 member 2Homo sapiens (Human)9606UniRef90_E5RGG8 28
A0A2J8TNP6_PONABSodium-dependent phosphate transporter 2 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef90_E5RGG8 78
A0A2J8N770_PANTRSodium-dependent phosphate transporter 2 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef90_E5RGG8 78
A0A2J8TNL6_PONABSodium-dependent phosphate transporter 2 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef90_E5RGG8 47
A0A2J8N764_PANTRSodium-dependent phosphate transporter 2 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef90_E5RGG8 47
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
Help