Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_A5VPI9 GTP pyrophosphokinase rsh n=10 Tax=Brucella TaxID=234 RepID=RSH_BRUO2 MMRQYELVERVQRYKPDVNEALLNKAYVYAMQKHGSQKRASGDPYFSHPLEVAAILTDMH LDEATIAIALLHDTIEDTTATRQEIDQLFGPEIGKLVEGLTKLKKLDLVSKKAVQAENLR KLLLAISEDVRVLLVKLADRLHNMRTLGVMREDKRLRIAEETMDIYAPLAGRMGMQDMRE ELEELAFRYINPDAWRAVTDRLAELLEKNRGLLQKIETDLSEIFEKNGIKASVKSRQKKP WSVFRKMETKGLSFEQLSDIFGFRVMVDTVQDCYRALGLIHTTWSMVPGRFKDYISTPKQ NDYRSIHTTIIGPSRQRIELQIRTREMDEIAEFGVAAHSIYKDRGSANNPHKISTETNAY AWLRQTIEQLSEGDNPEEFLEHTKLELFQDQVFCFTPKGRLIALPRGATPIDFAYAVHTD IGDSCVGAKVNGRIMPLMTELKNGDEVDIIRSKAQVPPAAWESLVATGKARAAIRRATRS AVRKQYSGLGMRILERAFERAGKPFSKDILKPGLPRLARKDVEDVLAAVGRGELPSTDVV KAVYPDYQDTRVTTQNNPAKAGEKGWFNIQNAAGMIFKVPEGGEGAAAKVDPAATTPKPG KRALPIRGTNPDLPVRFAPEGAVPGDRIVGILQPGAGITIYPIQSPALTAYDDQPERWID VRWDIDDQMSERFPARISVSAINSPGSLAEIAQIAAANDANIHNLSMVRTAPDFTEMIID VEVWDLKHLNRIISQLKESASVSSAKRVNG

Members

Expand cluster to 90% or 50% identity.
1 to 10 of 10  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A5VPI9RSH_BRUO2GTP pyrophosphokinase rshBrucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)444178750Representative
C0G538C0G538_9RHIZRelA/SpoT family proteinBrucella ceti str. Cudo595497760Seed
A0A1M4L9Q4A0A1M4L9Q4_9RHIZRelA/SpoT family proteinBrucella sp. 10RB92151149953750
A0A1P8S2B4A0A1P8S2B4_9RHIZGTP pyrophosphokinase rshBrucella sp. 09RB89101844051750
N8LZC4N8LZC4_BRUOVGTP pyrophosphokinase rshBrucella ovis IntaBari-2002-82-581293916750
A0A381B6A2A0A381B6A2_BRUNEGuanosine-3',5'-bis(Diphosphate) 3'-pyrophosphohydrolaseBrucella neotomae29460750
D0RGH4D0RGH4_9RHIZGTP pyrophosphokinase rshBrucella sp. F5/99437701750
A0A0E1X3I0A0A0E1X3I0_9RHIZGTP pyrophosphokinaseBrucella pinnipedialis M292/94/1520462750
C7LAW4C7LAW4_BRUMCRelA/SpoT family proteinBrucella microti (strain CCM 4915)568815750
D6LLT3D6LLT3_9RHIZGTP pyrophosphokinase rshBrucella sp. NVSL 07-0026520448176

Sequence

Representative sequenceiLengthMass (Da)Tools
A5VPI9

Checksumi: D717A5F11B802A6E

FASTA75083,914
        10         20         30         40         50
MMRQYELVER VQRYKPDVNE ALLNKAYVYA MQKHGSQKRA SGDPYFSHPL
60 70 80 90 100
EVAAILTDMH LDEATIAIAL LHDTIEDTTA TRQEIDQLFG PEIGKLVEGL
110 120 130 140 150
TKLKKLDLVS KKAVQAENLR KLLLAISEDV RVLLVKLADR LHNMRTLGVM
160 170 180 190 200
REDKRLRIAE ETMDIYAPLA GRMGMQDMRE ELEELAFRYI NPDAWRAVTD
210 220 230 240 250
RLAELLEKNR GLLQKIETDL SEIFEKNGIK ASVKSRQKKP WSVFRKMETK
260 270 280 290 300
GLSFEQLSDI FGFRVMVDTV QDCYRALGLI HTTWSMVPGR FKDYISTPKQ
310 320 330 340 350
NDYRSIHTTI IGPSRQRIEL QIRTREMDEI AEFGVAAHSI YKDRGSANNP
360 370 380 390 400
HKISTETNAY AWLRQTIEQL SEGDNPEEFL EHTKLELFQD QVFCFTPKGR
410 420 430 440 450
LIALPRGATP IDFAYAVHTD IGDSCVGAKV NGRIMPLMTE LKNGDEVDII
460 470 480 490 500
RSKAQVPPAA WESLVATGKA RAAIRRATRS AVRKQYSGLG MRILERAFER
510 520 530 540 550
AGKPFSKDIL KPGLPRLARK DVEDVLAAVG RGELPSTDVV KAVYPDYQDT
560 570 580 590 600
RVTTQNNPAK AGEKGWFNIQ NAAGMIFKVP EGGEGAAAKV DPAATTPKPG
610 620 630 640 650
KRALPIRGTN PDLPVRFAPE GAVPGDRIVG ILQPGAGITI YPIQSPALTA
660 670 680 690 700
YDDQPERWID VRWDIDDQMS ERFPARISVS AINSPGSLAE IAQIAAANDA
710 720 730 740 750
NIHNLSMVRT APDFTEMIID VEVWDLKHLN RIISQLKESA SVSSAKRVNG
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again