Essential maintenance is planned to begin on Fri Jan 24 2025. The website may be temporarily unavailable. Please use our fallback: https://wwwdev.ebi.ac.uk/uniprot/front-end/fallback/ in case of any outage.

UniRef · UniRef100_A0A7P0TAG4 (100%)

  • Cluster name
    Heat shock protein 90 beta family member 1
  • Composition
    10 members
  • Last updated
  • Seed
    Built on sequence A0A7P0TAG4
  • Common taxon

Representative

  • Length
    53
  • Mass (Da)
    5,885
  • MD5 Checksum
    D19167052E40C780826F0D5848DB2B9A
MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQRSR

10 members

Expand cluster to 50% or 90% identity
Cluster MembersEntry namesProtein namesOrganismsOrganism IDsRelated clustersLengthsRoles
A0A7P0TAG4_HUMANHeat shock protein 90 beta family member 1Homo sapiens (Human)9606UniRef50_A0A7P0TAG4 UniRef90_A0A7P0TAG4 53seed & representative
A0A2K6R485_RHIROHeat shock protein 90 beta family member 1Rhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef90_A0A7P0TAG4 53
A0A2J8N001_PANTRHSP90B1 isoform 10Pan troglodytes (Chimpanzee)9598UniRef90_A0A7P0TAG4 53
A0A2K5KXG7_CERATHeat shock protein 90 beta family member 1Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef90_A0A7P0TAG4 53
A0A8C0LLY5_CANLUHeat shock protein 90 beta family member 1Canis lupus dingo (dingo)286419UniRef90_A0A7P0TAG4 53
A0A2K5XP02_MANLEHeat shock protein 90 beta family member 1Mandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef90_A0A7P0TAG4 53
A0A2I3H7R6_NOMLEHeat shock protein 90 beta family member 1Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef90_A0A7P0TAG4 53
A0A2K6L3R3_RHIBEHeat shock protein 90 beta family member 1Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef90_A0A7P0TAG4 53
A0A2K6C9I4_MACNEHeat shock protein 90 beta family member 1Macaca nemestrina (Pig-tailed macaque)9545UniRef90_A0A7P0TAG4 53
A0A2K5K0Q5_COLAPEndoplasminColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef90_A0A7P0TAG4 53
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
Help