X5J815 · X5J815_9BACT
- ProteinThymidylate synthase
- GenethyA
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids264 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Catalyzes the reductive methylation of 2'-deoxyuridine-5'-monophosphate (dUMP) to 2'-deoxythymidine-5'-monophosphate (dTMP) while utilizing 5,10-methylenetetrahydrofolate (mTHF) as the methyl donor and reductant in the reaction, yielding dihydrofolate (DHF) as a by-product. This enzymatic reaction provides an intracellular de novo source of dTMP, an essential precursor for DNA biosynthesis.
Catalytic activity
- (6R)-5,10-methylene-5,6,7,8-tetrahydrofolate + dUMP = 7,8-dihydrofolate + dTMP
Pathway
Pyrimidine metabolism; dTTP biosynthesis.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 21 | dUMP (UniProtKB | ChEBI); ligand shared between dimeric partners; in other chain | ||||
Sequence: R | ||||||
Binding site | 51 | (6R)-5,10-methylene-5,6,7,8-tetrahydrofolate (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 126-127 | dUMP (UniProtKB | ChEBI); ligand shared between dimeric partners | ||||
Sequence: RR | ||||||
Active site | 146 | |||||
Sequence: C | ||||||
Active site | 146 | Nucleophile | ||||
Sequence: C | ||||||
Binding site | 166-169 | dUMP (UniProtKB | ChEBI); ligand shared between dimeric partners; in other chain | ||||
Sequence: RSAD | ||||||
Binding site | 169 | (6R)-5,10-methylene-5,6,7,8-tetrahydrofolate (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 177 | dUMP (UniProtKB | ChEBI); ligand shared between dimeric partners; in other chain | ||||
Sequence: N | ||||||
Binding site | 207-209 | dUMP (UniProtKB | ChEBI); ligand shared between dimeric partners; in other chain | ||||
Sequence: HLY | ||||||
Binding site | 263 | (6R)-5,10-methylene-5,6,7,8-tetrahydrofolate (UniProtKB | ChEBI) | ||||
Sequence: S |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | thymidylate synthase activity | |
Biological Process | dTMP biosynthetic process | |
Biological Process | dTTP biosynthetic process | |
Biological Process | methylation |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameThymidylate synthase
- EC number
- Short namesTS ; TSase
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Bacteroidota > Cytophagia > Cytophagales > Amoebophilaceae > Candidatus Cardinium
Accessions
- Primary accessionX5J815
Proteomes
Subcellular Location
Interaction
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 3-264 | Thymidylate synthase/dCMP hydroxymethylase | ||||
Sequence: PYLTLLQHILAEGVDKKDRTGTGTKSLFGYQMRFNLEEGFPLITTKKVHLRSIIYELLWFLSGDTNVRYLQEHGVTIWDEWASKEGRLGPIYGHQWRSWSTETGVKIDQISQTIKEIKTNPDSRRLLVSAWNVGEISKMALPPCHAFFQFYVANGKLSCQLYQRSADVFLGVPFNIASYGLLTMMMAQVCQLKPGTLIHTLGDAHLYYNHLEQASLQLKRSPYPLPTMQLNQNVTDLFSFVYEDFTLLHYLHHPAIKAVVSV |
Sequence similarities
Belongs to the thymidylate synthase family. Bacterial-type ThyA subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length264
- Mass (Da)30,270
- Last updated2014-06-11 v1
- Checksum4D2662D9028E62AE