W0T6B6 · ATG14_KLUMD
- ProteinAutophagy-related protein 14
- GeneATG14
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids305 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Required for cytoplasm to vacuole transport (Cvt) and autophagy as a part of the autophagy-specific VPS34 PI3-kinase complex I (By similarity).
This complex is essential to recruit the ATG8-phosphatidylinositol conjugate and the ATG12-ATG5 conjugate to the pre-autophagosomal structure (By similarity).
ATG14 mediates the specific binding of the VPS34 PI3-kinase complex I to the preautophagosomal structure (PAS) (By similarity).
This complex is essential to recruit the ATG8-phosphatidylinositol conjugate and the ATG12-ATG5 conjugate to the pre-autophagosomal structure (By similarity).
ATG14 mediates the specific binding of the VPS34 PI3-kinase complex I to the preautophagosomal structure (PAS) (By similarity).
Miscellaneous
Kluyveromyces marxianus proteins are shorter in length and have a more ordered secondary structure than their S.cerevisiae counterparts, which might contribute to the superior thermotolerance and solubility (PubMed:26442587).
K.marxianus could be therefore useful as a new model organism for further elucidation of the molecular details of autophagy (PubMed:26442587).
K.marxianus could be therefore useful as a new model organism for further elucidation of the molecular details of autophagy (PubMed:26442587).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | phagophore assembly site membrane | |
Cellular Component | protein-containing complex | |
Cellular Component | vacuolar membrane | |
Biological Process | macroautophagy | |
Biological Process | protein transport |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameAutophagy-related protein 14
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Kluyveromyces
Accessions
- Primary accessionW0T6B6
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Preautophagosomal structure membrane ; Peripheral membrane protein
Vacuole membrane ; Peripheral membrane protein
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Still forms preautophagosomal structures (PAS) in proximity to the vacuolar membrane (PubMed:26442587).
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000443911 | 1-305 | Autophagy-related protein 14 | |||
Sequence: MIHCGICGKAKTADVQFICCHCINGSPAVLLRDKMNLLILRQEVEQLKTAVEDQLETGFAGEGQLGRQLQKLDIYNEKRRLIKLRQRLQLARNKVQLKRNKYNELLQIMSTNGYLEESTSATDSIDLEEQAAEESASLDTLSHILARNQKQLFAELCRWFRIRKSDEDDVFSYTIWGLPMVNLKNGSELDPSIMVSSMRYLQQYLQLAFRIWLFKAICDKPIENDRNIIENFTQLIYDTLDILRARKLVSKSVSIRDILIRYDLDGMIYHLSQNKYLSSLDDASNSYPPTMQNIKQLVMSMIPSI |
Interaction
Subunit
Component of the autophagy-specific VPS34 PI3-kinase complex I (By similarity).
Structure
Family & Domains
Features
Showing features for coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 34-147 | |||||
Sequence: KMNLLILRQEVEQLKTAVEDQLETGFAGEGQLGRQLQKLDIYNEKRRLIKLRQRLQLARNKVQLKRNKYNELLQIMSTNGYLEESTSATDSIDLEEQAAEESASLDTLSHILAR |
Domain
Coiled-Coils at the N-terminal half are essential for autophagy (By similarity).
Sequence similarities
Belongs to the ATG14 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length305
- Mass (Da)35,265
- Last updated2014-03-19 v1
- ChecksumED8DAB9EF6EA0B0A