W0FJ62 · W0FJ62_9ENTR

Function

function

Required to load the replicative helix DnaB onto single-stranded (ss)DNA, to initiate chromosomal replication. DnaC alters the inter-domain and inter-subunit interactions of DnaB, inducing an open ring conformation that allows ssDNA to access the interior of the DnaB6:DnaC6 ring. Has ATPase activity only in the presence of DnaB and ssDNA. ssDNA binds to the central pore in the DnaB6:DnaC6 complex, making contacts with both subunits. It forms, in concert with DnaB protein and other prepriming proteins DnaT, N, N', N'' a prepriming protein complex on the specific site of the template DNA recognized by protein N'.

Catalytic activity

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Molecular FunctionATP binding
Molecular FunctionATP hydrolysis activity
Biological ProcessDNA replication

Keywords

Names & Taxonomy

Protein names

  • Recommended name
    Replicative helicase loader DnaC
  • Alternative names
    • DNA replication protein DnaC

Encoded on

  • Plasmid unnamed

Organism names

  • Taxonomic identifier
  • Strain
    • CCBH 10892
  • Taxonomic lineage
    Bacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Enterobacter > Enterobacter cloacae complex

Accessions

  • Primary accession
    W0FJ62

Interaction

Subunit

The helix loader is a DnaB6:DnaC6 complex with a crack opening large enough to allow ssDNA into the central cavity.

Family & Domains

Features

Showing features for domain.

TypeIDPosition(s)Description
Domain102-236AAA+ ATPase

Sequence similarities

Belongs to the DnaC family.
Belongs to the IS21/IS1162 putative ATP-binding protein family.

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    260
  • Mass (Da)
    29,396
  • Last updated
    2014-03-19 v1
  • Checksum
    5A869A58C1139E6B
MMVELQHQRLMVLAEQLQLDSLIGAAPALSQQAVDQEWSYMDFLEHLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQIQSLRSLSFIERNENIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTSQRQGRYKTTLNRGVMAPKLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTSAMLDRILHHSHVVQIKGESYRLKQKRKAGVIAEANPE

Keywords

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
KF727591
EMBL· GenBank· DDBJ
AHF22999.1
EMBL· GenBank· DDBJ
Genomic DNA

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp