V9HWG3 · V9HWG3_HUMAN
- ProteinProtein-glutamine gamma-glutamyltransferase 2
- GeneHEL-S-45
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids687 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
Catalytic activity
- (R)-noradrenaline + L-glutaminyl-[protein] = 5-(R)-noradrenalinyl-L-glutamyl-[protein] + NH4+This reaction proceeds in the forward direction.
- L-glutaminyl-[protein] + serotonin = 5-serotonyl-L-glutamyl-[protein] + NH4+This reaction proceeds in the forward direction.
- dopamine + L-glutaminyl-[protein] = 5-dopaminyl-L-glutamyl-[protein] + NH4+This reaction proceeds in the forward direction.
- histamine + L-glutaminyl-[protein] = 5-histaminyl-L-glutamyl-[protein] + NH4+This reaction proceeds in the forward direction.
Cofactor
Note: Binds 1 Ca2+ ion per subunit.
Features
Showing features for active site, binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 277 | |||||
Sequence: C | ||||||
Active site | 335 | |||||
Sequence: H | ||||||
Active site | 358 | |||||
Sequence: D | ||||||
Binding site | 398 | Ca2+ (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 400 | Ca2+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 447 | Ca2+ (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 452 | Ca2+ (UniProtKB | ChEBI) | ||||
Sequence: E |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | chromosome | |
Cellular Component | collagen-containing extracellular matrix | |
Cellular Component | cytosol | |
Cellular Component | endoplasmic reticulum | |
Cellular Component | extracellular region | |
Cellular Component | mitochondrion | |
Cellular Component | nucleus | |
Cellular Component | plasma membrane | |
Molecular Function | GTP binding | |
Molecular Function | metal ion binding | |
Molecular Function | peptidase activity | |
Molecular Function | protein-glutamine gamma-glutamyltransferase activity | |
Biological Process | branching involved in salivary gland morphogenesis | |
Biological Process | negative regulation of endoplasmic reticulum calcium ion concentration | |
Biological Process | positive regulation of cell adhesion | |
Biological Process | positive regulation of mitochondrial calcium ion concentration | |
Biological Process | proteolysis | |
Biological Process | regulation of apoptotic cell clearance | |
Biological Process | salivary gland cavitation |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein-glutamine gamma-glutamyltransferase 2
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionV9HWG3
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Disease & Variants
Organism-specific databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 269-361 | Transglutaminase-like | ||||
Sequence: CQRVKYGQCWVFAAVACTVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPTP |
Sequence similarities
Belongs to the transglutaminase superfamily. Transglutaminase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length687
- Mass (Da)77,329
- Last updated2014-03-19 v1
- Checksum7DA33FF335DE7B37
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
EU794665 EMBL· GenBank· DDBJ | ACJ13719.1 EMBL· GenBank· DDBJ | mRNA |