V5I962 · V5I962_ANOGL
- ProteinSterol carrier protein 2
- GeneNLTP
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids538 (go to sequence)
- Protein existencePredicted
- Annotation score5/5
Function
function
Mediates the transfer of all common phospholipids, cholesterol and gangliosides from the endoplasmic reticulum to the plasma membrane. May play a role in regulating steroidogenesis. Stimulates the microsomal conversion of 7-dehydrocholesterol to cholesterol. Also binds fatty acids and fatty acyl Coenzyme A (CoA) such as phytanoyl-CoA. Involved in the regulation phospholipid synthesis in endoplasmic reticulum enhancing the incorporation of exogenous fatty acid into glycerides. Seems to stimulate the rate-limiting step in phosphatidic acid formation mediated by GPAT3. Isoforms SCP2 and SCPx cooperate in peroxisomal oxidation of certain naturally occurring tetramethyl-branched fatty acyl-CoAs.
Plays a crucial role in the peroxisomal oxidation of branched-chain fatty acids. Catalyzes the last step of the peroxisomal beta-oxidation of branched chain fatty acids and the side chain of the bile acid intermediates di- and trihydroxycoprostanic acids (DHCA and THCA). Also active with medium and long straight chain 3-oxoacyl-CoAs. Stimulates the microsomal conversion of 7-dehydrocholesterol to cholesterol and transfers phosphatidylcholine and 7-dehydrocholesterol between membrances, in vitro. Isoforms SCP2 and SCPx cooperate in peroxisomal oxidation of certain naturally occurring tetramethyl-branched fatty acyl-CoAs.
Catalytic activity
- 3-oxo-(9Z-octadecenoyl)-CoA + CoA = (7Z)-hexadecenoyl-CoA + acetyl-CoAThis reaction proceeds in the forward direction.
- 3-oxohexadecanedioyl-CoA + CoA = tetradecanedioyl-CoA + acetyl-CoAThis reaction proceeds in the forward direction.
- 7-dehydrocholesterol(in) = 7-dehydrocholesterol(out)
- butanoyl-CoA + acetyl-CoA = 3-oxohexanoyl-CoA + CoAThis reaction proceeds in the backward direction.
- decanoyl-CoA + acetyl-CoA = 3-oxododecanoyl-CoA + CoAThis reaction proceeds in the backward direction.
- dodecanoyl-CoA + acetyl-CoA = 3-oxotetradecanoyl-CoA + CoAThis reaction proceeds in the backward direction.
- hexadecanoyl-CoA + acetyl-CoA = 3-oxooctadecanoyl-CoA + CoAThis reaction proceeds in the backward direction.
- hexanoyl-CoA + acetyl-CoA = 3-oxooctanoyl-CoA + CoAThis reaction proceeds in the backward direction.
- octanoyl-CoA + acetyl-CoA = 3-oxodecanoyl-CoA + CoAThis reaction proceeds in the backward direction.
- propanoyl-CoA + tetradecanoyl-CoA = 3-oxo-2-methylhexadecanoyl-CoA + CoAThis reaction proceeds in the backward direction.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrion | |
Cellular Component | peroxisome | |
Molecular Function | acetyl-CoA C-acyltransferase activity | |
Molecular Function | acetyl-CoA C-myristoyltransferase activity | |
Molecular Function | lipid binding | |
Molecular Function | propanoyl-CoA C-acyltransferase activity | |
Molecular Function | propionyl-CoA C2-trimethyltridecanoyltransferase activity | |
Biological Process | lipid transport |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSterol carrier protein 2
- EC number
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Coleoptera > Polyphaga > Cucujiformia > Chrysomeloidea > Cerambycidae > Lamiinae > Lamiini > Anoplophora
Accessions
- Primary accessionV5I962
Subcellular Location
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 4-227 | Thiolase N-terminal | ||||
Sequence: VFVIGVGMTKFEKPGKRTDDYPQWGKQAITAALTDANIHMSEVELATAGYVYGDSTSGQRVIYEVGMTGIPIFNVNNNCSTGSSALMLAKELVESGKYNCALALGFEKMERGSLSSKFMDRSNPMEKHIEAMSNLADIDGSPITAQMFGNAAIEHMKRYGTKAEHFAKIAYKNHKHSINNPYSQFQDEYTLDQILKSPKIYGPLTKLQCCPTSDGAAAAILASE | ||||||
Domain | 264-382 | Thiolase C-terminal | ||||
Sequence: VGYDMSKTAAERVFRKTNKDPSDVQVVELHDCFSANELITYEALGLCPPGRAGEFIDRGDNTYGGKFVVNPSGGLISKGHPLGATGLAQCSELCWQLRGEAERRQVANAKLALQHNIGL | ||||||
Domain | 425-524 | SCP2 | ||||
Sequence: ILQQAMEDDEEGLIENHRGIYALKVAKANGDTGTWVINCKTGKGKIEFNGKDKPDVTFIVKDSDVIELLTGKIPPQKAFFQGKVKIQGNIGLAVKLTELQ |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length538
- Mass (Da)58,794
- Last updated2014-01-22 v1
- Checksum2AEB7ECAB5E4D923
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
GALX01003490 EMBL· GenBank· DDBJ | JAB64976.1 EMBL· GenBank· DDBJ | Transcribed RNA |