V4KFG5 · V4KFG5_EUTSA
- ProteinPhotolyase/cryptochrome alpha/beta domain-containing protein
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids621 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
Cofactor
Note: Binds 1 FAD per subunit.
Features
Showing features for binding site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 232 | FAD (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 244-248 | FAD (UniProtKB | ChEBI) | ||||
Sequence: TSLLS | ||||||
Binding site | 287 | FAD (UniProtKB | ChEBI) | ||||
Sequence: F | ||||||
Site | 321 | Electron transfer via tryptophanyl radical | ||||
Sequence: W | ||||||
Site | 374 | Electron transfer via tryptophanyl radical | ||||
Sequence: W | ||||||
Binding site | 387-389 | FAD (UniProtKB | ChEBI) | ||||
Sequence: DAD | ||||||
Site | 397 | Electron transfer via tryptophanyl radical | ||||
Sequence: W |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended namePhotolyase/cryptochrome alpha/beta domain-containing protein
Gene names
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Eutremeae > Eutrema
Accessions
- Primary accessionV4KFG5
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 5-134 | Photolyase/cryptochrome alpha/beta | ||||
Sequence: KKTIVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSLKALGSELTLIKTHNTVSAILDCIRATGATKVVFNHLYDPVSLVRDHTVKEKLVELGISVQSYNGDLL |
Sequence similarities
Belongs to the DNA photolyase class-1 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length621
- Mass (Da)70,165
- Last updated2014-01-22 v1
- ChecksumB6E486403CD24B99
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
KI517683 EMBL· GenBank· DDBJ | ESQ36485.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KI517683 EMBL· GenBank· DDBJ | ESQ36486.1 EMBL· GenBank· DDBJ | Genomic DNA |