U6CU29 · U6CU29_NEOVI
- ProteinPlatelet-activating factor acetylhydrolase
- GenePAFA
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids445 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
Catalytic activity
- 1-O-decyl-2-acetyl-sn-glycero-3-phosphocholine + H2O = 1-O-decyl-sn-glycero-3-phosphocholine + acetate + H+This reaction proceeds in the forward direction.
- 1-O-dodecyl-2-acetyl-sn-glycero-3-phosphocholine + H2O = 1-O-dodecyl-sn-glycero-3-phosphocholine + acetate + H+This reaction proceeds in the forward direction.
- 1-O-hexadecyl-2-acetyl-sn-glycero-3-phosphocholine + H2O = 1-O-hexadecyl-sn-glycero-3-phosphocholine + acetate + H+This reaction proceeds in the forward direction.
- 1-O-octadecyl-2-acetyl-sn-glycero-3-phosphocholine + H2O = 1-O-octadecyl-sn-glycero-3-phosphocholine + acetate + H+This reaction proceeds in the forward direction.
- 1-O-tetradecyl-2-acetyl-sn-glycero-3-phosphocholine + H2O = 1-O-tetradecyl-sn-glycero-3-phosphocholine + acetate + H+This reaction proceeds in the forward direction.
- 1-hexadecanoyl-2-(10-hydroperoxy-8E-octadecenoyl)-sn-glycero-3-phosphocholine + H2O = 1-hexadecanoyl-sn-glycero-3-phosphocholine + 10-hydroperoxy-(8E)-octadecenoate + H+This reaction proceeds in the forward direction.
- 1-hexadecanoyl-2-(5-oxopentanoyl)-sn-glycero-3-phosphocholine + H2O = 1-hexadecanoyl-sn-glycero-3-phosphocholine + 5-oxopentanoate + H+This reaction proceeds in the forward direction.
- 1-hexadecanoyl-2-(9-oxononanoyl)-sn-glycero-3-phosphocholine + H2O = 1-hexadecanoyl-sn-glycero-3-phosphocholine + 9-oxononanoate + H+This reaction proceeds in the forward direction.
- 1-hexadecanoyl-2-[9-hydroperoxy-(10E-octadecenoyl)]-sn-glycero-3-phosphocholine + H2O = 1-hexadecanoyl-sn-glycero-3-phosphocholine + 9-hydroperoxy-10E-octadecenoate + H+This reaction proceeds in the forward direction.
- 1-hexadecanoyl-2-acetyl-sn-glycero-3-phosphocholine + H2O = 1-hexadecanoyl-sn-glycero-3-phosphocholine + acetate + H+This reaction proceeds in the forward direction.
- 1-hexadecanoyl-2-butanoyl-sn-glycero-3-phosphocholine + H2O = 1-hexadecanoyl-sn-glycero-3-phosphocholine + butanoate + H+This reaction proceeds in the forward direction.
- 1-hexadecanoyl-2-glutaroyl-sn-glycero-3-phosphocholine + H2O = 1-hexadecanoyl-sn-glycero-3-phosphocholine + glutarate + H+This reaction proceeds in the forward direction.
- 1-hexadecanoyl-2-pentanoyl-sn-glycero-3-phosphocholine + H2O = 1-hexadecanoyl-sn-glycero-3-phosphocholine + H+ + pentanoateThis reaction proceeds in the forward direction.
- 1-hexadecanoyl-2-propionyl-sn-glycero-3-phosphocholine + H2O = 1-hexadecanoyl-sn-glycero-3-phosphocholine + H+ + propanoateThis reaction proceeds in the forward direction.
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 275 | Nucleophile | ||||
Sequence: S | ||||||
Active site | 298 | Charge relay system | ||||
Sequence: D | ||||||
Active site | 353 | Charge relay system | ||||
Sequence: H |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | high-density lipoprotein particle | |
Cellular Component | low-density lipoprotein particle | |
Molecular Function | 1-alkyl-2-acetylglycerophosphocholine esterase activity | |
Molecular Function | calcium-independent phospholipase A2 activity | |
Molecular Function | phospholipid binding | |
Biological Process | lipid oxidation | |
Biological Process | low-density lipoprotein particle remodeling | |
Biological Process | phosphatidylcholine catabolic process | |
Biological Process | plasma lipoprotein particle oxidation | |
Biological Process | platelet activating factor catabolic process | |
Biological Process | positive regulation of monocyte chemotaxis |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePlatelet-activating factor acetylhydrolase
- EC number
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Carnivora > Caniformia > Musteloidea > Mustelidae > Mustelinae > Neogale
Accessions
- Primary accessionU6CU29
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-21 | |||||
Sequence: MLPPKVHALFCLCSCLALVHP | ||||||
Chain | PRO_5040664265 | 22-445 | Platelet-activating factor acetylhydrolase | |||
Sequence: IDWQDLNPVAQIRSSAWANKIQALMAAASVGQSKIPKGNGSYSVGCTDLMFDYTKKGTFLRLYYPSQEEDHHSDTLWIPNKEYFFGLSKYLGTHWLMGKILSLFFGSMTTPAEWNSPLRTGEKYPLIVFSHGLGAFRTIYSAIGIDLASYGFIVAAVEHRDGSASATYYFQDQSAAEIGNKSWLYLQSLKTEEEEMSVRSEQVQKRAKECSQALDLILDIDRGRPVKNVLDLEFDVEQLKDSIDRDKIAVIGHSFGGATVVQTLSEDQRFRCGIALDAWMAPLDDEIFPRIPQPLFFINSERFQYPANIEKMEKCYSPGKERKMITIRGSVHQNFADFTFATGKIIGYIFTLKGDIDSNVALGLSNKASLAFLQKHLGLQKDFDQWDSLIEGKDANLIPGTNINITSHDVSLQNSTETEQQHLD |
Keywords
- PTM
Structure
Sequence
- Sequence statusComplete
- Length445
- Mass (Da)49,954
- Last updated2014-01-22 v1
- Checksum63378AF46D95724E
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8C7ENJ0 | A0A8C7ENJ0_NEOVI | 430 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
HAAF01001988 EMBL· GenBank· DDBJ | CCP73814.1 EMBL· GenBank· DDBJ | mRNA |