U5YCR8 · VSP_BOTPC
- ProteinSnake venom serine protease pictobin
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids250 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Snake venom serine protease that may impair the hemostatic system of the prey.
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 57 | Charge relay system | ||||
Sequence: H | ||||||
Active site | 102 | Charge relay system | ||||
Sequence: D | ||||||
Active site | 196 | Charge relay system | ||||
Sequence: S |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | secretory granule | |
Molecular Function | serine-type endopeptidase activity | |
Molecular Function | toxin activity | |
Biological Process | proteolysis |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSnake venom serine protease pictobin
- EC number
- Short namesSVSP
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Lepidosauria > Squamata > Bifurcata > Unidentata > Episquamata > Toxicofera > Serpentes > Colubroidea > Viperidae > Crotalinae > Bothrops
Accessions
- Primary accessionU5YCR8
Subcellular Location
PTM/Processing
Features
Showing features for signal, propeptide, chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-11 | |||||
Sequence: ANLLILQVSYA | ||||||
Propeptide | PRO_0000432785 | 12-17 | ||||
Sequence: QKSSEL | ||||||
Chain | PRO_0000432786 | 18-250 | Snake venom serine protease pictobin | |||
Sequence: VIGGDECNINEHRFLAFTYSRGFFCGGTLINQEWVLTATHCDRIFMRIYLGLHNQSVRYDDQQIRYPKEKYFFPCSKNFTKWDKDIMLIRLDRPVKNSEHIAPLSLPSNPPSVGSVCRVMGWGTITAPNDTYPDVPHCANINLFNYTVCRGAYKGLPATSRTLCAGVLQGGIDTCVGDSGGPLICNGQFQGIVFWGGDPCAQPRKPALYTKVFDHLHWILSIIAGNTTATCPP | ||||||
Disulfide bond | 24↔155 | |||||
Sequence: CNINEHRFLAFTYSRGFFCGGTLINQEWVLTATHCDRIFMRIYLGLHNQSVRYDDQQIRYPKEKYFFPCSKNFTKWDKDIMLIRLDRPVKNSEHIAPLSLPSNPPSVGSVCRVMGWGTITAPNDTYPDVPHC | ||||||
Disulfide bond | 42↔58 | |||||
Sequence: CGGTLINQEWVLTATHC | ||||||
Glycosylation | 71 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 95 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 134↔202 | |||||
Sequence: CRVMGWGTITAPNDTYPDVPHCANINLFNYTVCRGAYKGLPATSRTLCAGVLQGGIDTCVGDSGGPLIC | ||||||
Glycosylation | 146 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 162 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 166↔181 | |||||
Sequence: CRGAYKGLPATSRTLC | ||||||
Disulfide bond | 192↔217 | |||||
Sequence: CVGDSGGPLICNGQFQGIVFWGGDPC | ||||||
Glycosylation | 243 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Expression
Tissue specificity
Expressed by the venom gland.
Interaction
Subunit
Monomer.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 18-241 | Peptidase S1 | ||||
Sequence: VIGGDECNINEHRFLAFTYSRGFFCGGTLINQEWVLTATHCDRIFMRIYLGLHNQSVRYDDQQIRYPKEKYFFPCSKNFTKWDKDIMLIRLDRPVKNSEHIAPLSLPSNPPSVGSVCRVMGWGTITAPNDTYPDVPHCANINLFNYTVCRGAYKGLPATSRTLCAGVLQGGIDTCVGDSGGPLICNGQFQGIVFWGGDPCAQPRKPALYTKVFDHLHWILSIIA |
Sequence similarities
Belongs to the peptidase S1 family. Snake venom subfamily.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusFragment
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length250
- Mass (Da)27,783
- Last updated2014-01-22 v1
- Checksum191CF26C461546C5
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: A |