U5TPM4 · U5TPM4_COWPX
- ProteinProtein OPG166
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids277 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Promotes, when overexpressed, the influx of extracellular Ca2+, leading to membrane permeability and host cell necrosis.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular exosome | |
Cellular Component | host cell membrane | |
Cellular Component | plasma membrane | |
Molecular Function | thrombospondin receptor activity | |
Biological Process | positive regulation of cell-cell adhesion | |
Biological Process | positive regulation of inflammatory response | |
Biological Process | positive regulation of phagocytosis |
Names & Taxonomy
Protein names
- Recommended nameProtein OPG166
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageViruses > Varidnaviria > Bamfordvirae > Nucleocytoviricota > Pokkesviricetes > Chitovirales > Poxviridae > Chordopoxvirinae > Orthopoxvirus
- Virus hosts
Accessions
- Primary accessionU5TPM4
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Host membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 125-144 | Helical | ||||
Sequence: MLMFIFTGITLFLLFLEIAY | ||||||
Transmembrane | 156-177 | Helical | ||||
Sequence: GILQVFGCIIAMIELCGAFLFY | ||||||
Transmembrane | 183-201 | Helical | ||||
Sequence: LRHIIGLLMMTLPSIFLII | ||||||
Transmembrane | 213-235 | Helical | ||||
Sequence: LSCAVHLIIYYQLAGYILTVLGL | ||||||
Transmembrane | 247-269 | Helical | ||||
Sequence: LLLSGLGTIMVSEHFSLLFLVCF |
Keywords
- Cellular component
PTM/Processing
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 4-122 | CD47 immunoglobulin-like | ||||
Sequence: VRILLIYLCTFVVITSTKTIEYTACNYTIIIPCTIDNPTKYIRWKLDNHDILTYNKTSKTTILSKWHTSAKLHSLSDNDVSLIIEYKDILPGTYTCEDNTGIKSTVKLVQRHTNWFNDH | ||||||
Domain | 126-269 | CD47-like transmembrane | ||||
Sequence: LMFIFTGITLFLLFLEIAYTSISVVFSTNLGILQVFGCIIAMIELCGAFLFYPSMFTLRHIIGLLMMTLPSIFLIITKVFSFWLLCKLSCAVHLIIYYQLAGYILTVLGLGLSLKECVDGTLLLSGLGTIMVSEHFSLLFLVCF |
Sequence similarities
Belongs to the orthopoxvirus OPG166 protein family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length277
- Mass (Da)31,633
- Last updated2014-01-22 v1
- ChecksumCABF27F7B703E6DF
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
KC813501 EMBL· GenBank· DDBJ | AGY99259.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KC813503 EMBL· GenBank· DDBJ | AGY99677.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KC813505 EMBL· GenBank· DDBJ | AGZ00107.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KC813508 EMBL· GenBank· DDBJ | AGZ00740.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KC813510 EMBL· GenBank· DDBJ | AGZ01160.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KC813512 EMBL· GenBank· DDBJ | AGZ01584.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK035746 EMBL· GenBank· DDBJ | AZY89032.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK035747 EMBL· GenBank· DDBJ | AZY89213.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK035748 EMBL· GenBank· DDBJ | AZY89399.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK035749 EMBL· GenBank· DDBJ | AZY89581.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK035750 EMBL· GenBank· DDBJ | AZY89757.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK035753 EMBL· GenBank· DDBJ | AZY90307.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK035757 EMBL· GenBank· DDBJ | AZY91054.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK035759 EMBL· GenBank· DDBJ | AZY91429.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
LN864565 EMBL· GenBank· DDBJ | CRL86667.1 EMBL· GenBank· DDBJ | Genomic DNA |