U3N2M0 · U3N2M0_YEASX
- ProteinMating factor alpha
- GeneMFalpha2
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids120 (go to sequence)
- Protein existencePredicted
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | mating pheromone activity | |
Biological Process | mating | |
Biological Process | pheromone-dependent signal transduction involved in conjugation with cellular fusion |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameMating factor alpha
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionU3N2M0
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-19 | |||||
Sequence: MKFISTFLTFILAAVSVTA | ||||||
Chain | PRO_5014594146 | 20-120 | Mating factor alpha | |||
Sequence: SSDEDIAQVPAEAIIGYLDFGGDHDIAFLPFSNATASGLLFINTTIAEAAEKEQNTTLAKREAVADAWHWLNLRPGQPMYKREANADAWHWLQLKPGQPMY |
Structure
Family & Domains
Sequence
- Sequence statusComplete
- Length120
- Mass (Da)13,271
- Last updated2013-12-11 v1
- Checksum10BF3FDB985FBB2D
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
KF183427 EMBL· GenBank· DDBJ | AGW25002.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183428 EMBL· GenBank· DDBJ | AGW25003.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183429 EMBL· GenBank· DDBJ | AGW25004.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183432 EMBL· GenBank· DDBJ | AGW25007.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183435 EMBL· GenBank· DDBJ | AGW25010.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183436 EMBL· GenBank· DDBJ | AGW25011.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183437 EMBL· GenBank· DDBJ | AGW25012.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183438 EMBL· GenBank· DDBJ | AGW25013.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183440 EMBL· GenBank· DDBJ | AGW25015.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183441 EMBL· GenBank· DDBJ | AGW25016.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183443 EMBL· GenBank· DDBJ | AGW25018.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183445 EMBL· GenBank· DDBJ | AGW25020.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183448 EMBL· GenBank· DDBJ | AGW25023.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183449 EMBL· GenBank· DDBJ | AGW25024.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183456 EMBL· GenBank· DDBJ | AGW25031.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183457 EMBL· GenBank· DDBJ | AGW25032.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183466 EMBL· GenBank· DDBJ | AGW25041.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183468 EMBL· GenBank· DDBJ | AGW25043.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183475 EMBL· GenBank· DDBJ | AGW25050.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183478 EMBL· GenBank· DDBJ | AGW25053.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183480 EMBL· GenBank· DDBJ | AGW25055.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183481 EMBL· GenBank· DDBJ | AGW25056.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183487 EMBL· GenBank· DDBJ | AGW25062.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183488 EMBL· GenBank· DDBJ | AGW25063.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183489 EMBL· GenBank· DDBJ | AGW25064.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183490 EMBL· GenBank· DDBJ | AGW25065.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183491 EMBL· GenBank· DDBJ | AGW25066.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183492 EMBL· GenBank· DDBJ | AGW25067.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183494 EMBL· GenBank· DDBJ | AGW25069.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF183495 EMBL· GenBank· DDBJ | AGW25070.1 EMBL· GenBank· DDBJ | Genomic DNA |