U3KA11 · U3KA11_FICAL

Function

Catalytic activity

  • Exonucleolytic cleavage of poly(A) to 5'-AMP.
    EC:3.1.13.4 (UniProtKB | ENZYME | Rhea)

Cofactor

Co2+ (UniProtKB | Rhea| CHEBI:48828 )

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular ComponentCCR4-NOT core complex
Cellular Componentnuclear speck
Cellular ComponentP-body
Molecular FunctionDNA-binding transcription factor binding
Molecular Functionnucleic acid binding
Molecular Functionpoly(A)-specific ribonuclease activity
Molecular Functiontranscription corepressor activity
Biological Processdeadenylation-dependent decapping of nuclear-transcribed mRNA
Biological Processdefense response to virus
Biological Processnegative regulation of cell population proliferation
Biological Processnegative regulation of type I interferon-mediated signaling pathway
Biological Processnuclear-transcribed mRNA poly(A) tail shortening
Biological ProcessP-body assembly
Biological Processpositive regulation of cell population proliferation
Biological Processpositive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
Biological Processpositive regulation of nuclear-transcribed mRNA poly(A) tail shortening
Biological Processpositive regulation of transcription by RNA polymerase II
Biological Processpositive regulation of viral genome replication
Biological Processregulation of tyrosine phosphorylation of STAT protein
Biological Processregulatory ncRNA-mediated gene silencing

Keywords

Enzyme and pathway databases

Names & Taxonomy

Protein names

  • Recommended name
    CCR4-NOT transcription complex subunit 7
  • EC number
  • Alternative names
    • CCR4-associated factor 1

Gene names

    • Name
      CNOT7

Organism names

Accessions

  • Primary accession
    U3KA11

Proteomes

Subcellular Location

Interaction

Protein-protein interaction databases

Family & Domains

Sequence similarities

Belongs to the CAF1 family.

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    286
  • Mass (Da)
    32,852
  • Last updated
    2021-09-29 v2
  • Checksum
    D5AFBD08DB1531FC
MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREVCGHSVFTSMIVMFCVSDMGLLILPSQWYFKEVSEGLQGSILS

Computationally mapped potential isoform sequences

There are 3 potential isoforms mapped to this entry

View all
EntryEntry nameGene nameLength
A0A803W9Y6A0A803W9Y6_FICALCNOT7231
A0A803WA75A0A803WA75_FICALCNOT7285
A0A803VI54A0A803VI54_FICALCNOT7248

Keywords

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp