S9TRB0 · S9TRB0_PAEAL
- ProteinMultifunctional fusion protein
- GenemsrA
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids328 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.
Catalytic activity
- [thioredoxin]-disulfide + H2O + L-methionine = [thioredoxin]-dithiol + L-methionine (S)-S-oxide
RHEA-COMP:10700 CHEBI:50058 Position: n/n+3+ CHEBI:15377 + CHEBI:57844 = RHEA-COMP:10698 CHEBI:29950 Position: nCHEBI:29950 Position: n+3+ CHEBI:58772
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 21 | |||||
Sequence: C | ||||||
Active site | 299 | Nucleophile | ||||
Sequence: C |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | L-methionine:thioredoxin-disulfide S-oxidoreductase activity | |
Molecular Function | peptide-methionine (R)-S-oxide reductase activity | |
Molecular Function | peptide-methionine (S)-S-oxide reductase activity | |
Biological Process | protein modification process | |
Biological Process | protein repair | |
Biological Process | response to oxidative stress |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameMultifunctional fusion protein
Including 2 domains:
- Recommended namePeptide methionine sulfoxide reductase MsrA
- EC number
- Short namesProtein-methionine-S-oxide reductase
- Alternative names
- Recommended namePeptide methionine sulfoxide reductase MsrB
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Bacillota > Bacilli > Bacillales > Paenibacillaceae > Paenibacillus
Accessions
- Primary accessionS9TRB0
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 188-310 | MsrB | ||||
Sequence: RAALQGKLTPIQYRVTQQNGTEPPFSNEYWNHEAEGIYVDIVSGEPLFSSLDKFDAGCGWPSFSKPLRSNHVENKLDTSHGMVRVEVRSKLADSHLGHVFDDGPTPTGLRYCINSAALRFIPK |
Sequence similarities
Belongs to the MsrA Met sulfoxide reductase family.
Belongs to the MsrB Met sulfoxide reductase family.
In the C-terminal section; belongs to the MsrB Met sulfoxide reductase family.
In the N-terminal section; belongs to the MsrA Met sulfoxide reductase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length328
- Mass (Da)37,090
- Last updated2013-10-16 v1
- ChecksumF82BF745609B2C12
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
ATMT01000076 EMBL· GenBank· DDBJ | EPY04846.1 EMBL· GenBank· DDBJ | Genomic DNA |