S5M6I3 · S5M6I3_9TELE
- ProteinCytochrome c oxidase subunit 1
- GeneCOI
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids187 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Catalytic activity
- 4 Fe(II)-[cytochrome c] + 8 H+(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H+(out) + 2 H2OThis reaction proceeds in the forward direction.
4 RHEA-COMP:10350 + 8 H+ (in)CHEBI:15378+ CHEBI:15379 = 4 RHEA-COMP:14399 + 4 H+ (out)CHEBI:15378+ 2 CHEBI:15377
Cofactor
Protein has several cofactor binding sites:
Pathway
Energy metabolism; oxidative phosphorylation.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Cellular Component | respirasome | |
Molecular Function | cytochrome-c oxidase activity | |
Molecular Function | heme binding | |
Molecular Function | metal ion binding | |
Biological Process | oxidative phosphorylation |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCytochrome c oxidase subunit 1
- EC number
Gene names
Encoded on
- Mitochondrion
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Neoteleostei > Acanthomorphata > Ovalentaria > Atherinomorphae > Atheriniformes > Atherinopsidae > Atherinopsinae > Odontesthes
Accessions
- Primary accessionS5M6I3
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Mitochondrion inner membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 18-48 | Helical | ||||
Sequence: IYNVIVTAHAFVMIFFMVMPIMIGGFGNWLI | ||||||
Transmembrane | 69-93 | Helical | ||||
Sequence: LLPPSFLLLLASSGVEAGAGTGWTV | ||||||
Transmembrane | 113-136 | Helical | ||||
Sequence: FSLHLAGVSSILGAINFITTIINM | ||||||
Transmembrane | 148-175 | Helical | ||||
Sequence: LFVWAVLITAVLLLLSLPVLAAGITMLL |
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-187 | Cytochrome oxidase subunit I profile | ||||
Sequence: LIRAELSQPGSLLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLIPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSGVEAGAGTGWTVYPPLSGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAISQYQTPLFVWAVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDP |
Sequence similarities
Belongs to the heme-copper respiratory oxidase family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusFragment
- Length187
- Mass (Da)20,062
- Last updated2013-10-16 v1
- Checksum2523BE83E55A6A70
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: L | ||||||
Non-terminal residue | 187 | |||||
Sequence: P |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
KF254405 EMBL· GenBank· DDBJ | AGR33583.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF254406 EMBL· GenBank· DDBJ | AGR33584.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF254407 EMBL· GenBank· DDBJ | AGR33585.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF254408 EMBL· GenBank· DDBJ | AGR33586.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF254409 EMBL· GenBank· DDBJ | AGR33587.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF254410 EMBL· GenBank· DDBJ | AGR33588.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF254411 EMBL· GenBank· DDBJ | AGR33589.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF254412 EMBL· GenBank· DDBJ | AGR33590.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF254413 EMBL· GenBank· DDBJ | AGR33591.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF254414 EMBL· GenBank· DDBJ | AGR33592.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF254416 EMBL· GenBank· DDBJ | AGR33594.1 EMBL· GenBank· DDBJ | Genomic DNA |