S4S378 · S4S378_9RODE
- ProteinBRCA1
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids609 (go to sequence)
- Protein existencePredicted
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | BRCA1-A complex | |
Cellular Component | BRCA1-BARD1 complex | |
Cellular Component | plasma membrane | |
Molecular Function | ubiquitin-protein transferase activity | |
Biological Process | chordate embryonic development | |
Biological Process | dosage compensation by inactivation of X chromosome | |
Biological Process | double-strand break repair via homologous recombination | |
Biological Process | negative regulation of fatty acid biosynthetic process | |
Biological Process | positive regulation of transcription by RNA polymerase II |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Submitted names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Gerbillinae > Gerbilliscus
Accessions
- Primary accessionS4S378
Subcellular Location
Structure
Family & Domains
Features
Showing features for domain, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 9-170 | BRCA1 serine-rich | ||||
Sequence: DSLCGRKKCNNQKSLCLEDSGAAQNVPWITLNSXIRKVNEWFSRTGEMLTSDSASDKRQASNAEAAVALEVSNEVDGCIGNSKKIDLVTSDPHHALMGKSEKDFSQPVKNNIXDKIFGKTYXRKGSFLHLNHVTEIISTFTAEPQMTQEQPFTNKLKRKRRS | ||||||
Compositional bias | 193-219 | Polar residues | ||||
Sequence: NINQGTDQMEPNDQMMGITSNGQENET | ||||||
Region | 193-231 | Disordered | ||||
Sequence: NINQGTDQMEPNDQMMGITSNGQENETKSNDLQKEKTAN | ||||||
Region | 283-429 | Disordered | ||||
Sequence: CALEPVSRDPSSPTHAELQIDSYSSSEETKKNNSNQTLVKHIRKPQLIEDPEPAPDAKKKEPNEQMRKRTASDAFPEEKLTNIDGSSSSEPEGPVSPSPQKREIEKLXSSKMPDNTKELTDLVLGGERCLSTERSEESTSVSLVPDT | ||||||
Compositional bias | 294-323 | Polar residues | ||||
Sequence: SPTHAELQIDSYSSSEETKKNNSNQTLVKH | ||||||
Compositional bias | 325-357 | Basic and acidic residues | ||||
Sequence: RKPQLIEDPEPAPDAKKKEPNEQMRKRTASDAF | ||||||
Compositional bias | 363-377 | Polar residues | ||||
Sequence: TNIDGSSSSEPEGPV |
Family and domain databases
Sequence
- Sequence statusFragment
- Length609
- Mass (Da)67,206
- Last updated2013-10-16 v1
- Checksum9404B05F7C7B6B79
Features
Showing features for non-terminal residue, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: E | ||||||
Compositional bias | 193-219 | Polar residues | ||||
Sequence: NINQGTDQMEPNDQMMGITSNGQENET | ||||||
Compositional bias | 294-323 | Polar residues | ||||
Sequence: SPTHAELQIDSYSSSEETKKNNSNQTLVKH | ||||||
Compositional bias | 325-357 | Basic and acidic residues | ||||
Sequence: RKPQLIEDPEPAPDAKKKEPNEQMRKRTASDAF | ||||||
Compositional bias | 363-377 | Polar residues | ||||
Sequence: TNIDGSSSSEPEGPV | ||||||
Non-terminal residue | 609 | |||||
Sequence: E |