R4VDZ1 · R4VDZ1_BBWV2
- ProteinRNA1 polyprotein
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids1869 (go to sequence)
- Protein existencePredicted
- Annotation score3/5
Function
function
Plays a role in RNA replication. It is covalently linked to the 5'terminus of both viral single-stranded RNA1 and RNA2 molecules.
Replicates the viral genome.
The protease cofactor and the putative helicase seem to target the replication complexes to ER membranes. Their physical association causes the membrane rearrangement of host ER that may result in formation of the small membranous vesicles that are the site of viral RNA synthesis.
Thiol protease that cleaves the RNA1 and RNA2 polyproteins.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell endoplasmic reticulum | |
Cellular Component | host cell membrane | |
Cellular Component | host cell perinuclear region of cytoplasm | |
Cellular Component | membrane | |
Molecular Function | ATP binding | |
Molecular Function | cysteine-type endopeptidase activity | |
Molecular Function | RNA binding | |
Molecular Function | RNA helicase activity | |
Molecular Function | RNA-dependent RNA polymerase activity | |
Biological Process | DNA-templated transcription | |
Biological Process | proteolysis | |
Biological Process | viral RNA genome replication |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameRNA1 polyprotein
- Alternative names
Organism names
- Organism
- Strain
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Pisuviricota > Pisoniviricetes > Picornavirales > Secoviridae > Comovirinae > Fabavirus > Fabavirus betaviciae
Accessions
- Primary accessionR4VDZ1
Subcellular Location
UniProt Annotation
GO Annotation
Host membrane ; Single-pass membrane protein
Membrane ; Single-pass membrane protein
PTM/Processing
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 485-653 | SF3 helicase | ||||
Sequence: LEKLIELHNSVVMAGSNTTRKSPFMVFFTGASGTGKTSVVQRVAINWLQEEQLGTSEIYARNGQDPFWSGYKRHAVVTYDDFGAVPGTTSNEAEIINVISRNPYATVMAGLAEKGMYFDSRLVLASSNFLAANPESGVHDSEAYERRRHAVVRVSLKPGVPYNANDPCA | ||||||
Domain | 962-1164 | Peptidase C3 | ||||
Sequence: SSCFGDSALWIAETCMATLTFSNVRTQVCLAPGRGFFGVNHCLAAIPAGVMVKLDSSIGVTYFVWEKEKLTQFEGNEIALYMTSTMPKTVDSLLSRIHFDAETLPKTFNAVFFSYKYDPVIQQMVPELGSVTCKIHNKAFTLAHGEYRREIPQSLTYEASTVAGDCGSLILAEIEGKFKLVGMHVAFNGKEGSASFMPYHASL | ||||||
Domain | 1444-1571 | RdRp catalytic | ||||
Sequence: NNILCCDYSRFDGFLPKCIMNEIGDMIARVMRANDESKTQIKNLMLACTSRYAMCNRILYRVENGIPSGFPLTVIVNSILNEILVKYAYWHCFVDNPTVQSNFDAHVSMVVYGDDNLISVSDAISSKF |
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,869
- Mass (Da)210,017
- Last updated2013-07-24 v1
- Checksum194F842BB98CF65D