Q9ZWS7 · ARR7_ARATH
- ProteinTwo-component response regulator ARR7
- GeneARR7
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids206 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Type-A response regulators seem to act as negative regulators of the cytokinin signaling.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | phosphorelay response regulator activity | |
Biological Process | cytokinin-activated signaling pathway | |
Biological Process | regulation of DNA-templated transcription | |
Biological Process | response to cytokinin | |
Biological Process | stem cell population maintenance |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameTwo-component response regulator ARR7
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9ZWS7
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000081428 | 1-206 | Two-component response regulator ARR7 | |||
Sequence: MAVGEVMRMEIPAGGDLTVTTPELHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGLDGGKGASNLKDLKVNLIVTDYSMPGLSGYDLLKKIKESSAFREVPVVIMSSENILPRIQECLKEGAEEFLLKPVKLADVKRIKQLIMRNEAEECKILSHSNKRKLQEDSDTSSSSHDDTSIKDSSCSKRMKSESENLFSLL | ||||||
Modified residue | 85 | 4-aspartylphosphate | ||||
Sequence: D |
Post-translational modification
Two-component system major event consists of a His-to-Asp phosphorelay between a sensor histidine kinase (HK) and a response regulator (RR). In plants, the His-to-Asp phosphorelay involves an additional intermediate named Histidine-containing phosphotransfer protein (HPt). This multistep phosphorelay consists of a His-Asp-His-Asp sequential transfer of a phosphate group between first a His and an Asp of the HK protein, followed by the transfer to a conserved His of the HPt protein and finally the transfer to an Asp in the receiver domain of the RR protein.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Predominantly expressed in roots and young flowers.
Induction
By cytokinins (BA and zeatin) and nitrate.
Gene expression databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9ZWS7 | AHP2 Q9ZNV8 | 6 | EBI-1100917, EBI-1100687 | |
BINARY | Q9ZWS7 | AHP3 Q9SAZ5 | 4 | EBI-1100917, EBI-1100711 | |
BINARY | Q9ZWS7 | At1g03430 Q67XQ1 | 3 | EBI-1100917, EBI-1100725 | |
BINARY | Q9ZWS7 | NUDT3 Q8L831 | 2 | EBI-1100917, EBI-1807753 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 25-152 | Response regulatory | ||||
Sequence: HVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGLDGGKGASNLKDLKVNLIVTDYSMPGLSGYDLLKKIKESSAFREVPVVIMSSENILPRIQECLKEGAEEFLLKPVKLADVKRIKQLIM | ||||||
Compositional bias | 165-195 | Basic and acidic residues | ||||
Sequence: SNKRKLQEDSDTSSSSHDDTSIKDSSCSKRM | ||||||
Region | 165-206 | Disordered | ||||
Sequence: SNKRKLQEDSDTSSSSHDDTSIKDSSCSKRMKSESENLFSLL |
Sequence similarities
Belongs to the ARR family. Type-A subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length206
- Mass (Da)22,800
- Last updated1999-05-01 v1
- ChecksumD13D14A540014DEB
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 165-195 | Basic and acidic residues | ||||
Sequence: SNKRKLQEDSDTSSSSHDDTSIKDSSCSKRM |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB008490 EMBL· GenBank· DDBJ | BAA34729.1 EMBL· GenBank· DDBJ | mRNA | ||
AC068602 EMBL· GenBank· DDBJ | AAF79300.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE29795.1 EMBL· GenBank· DDBJ | Genomic DNA |