Q9ZVZ9 · PB27B_ARATH
- ProteinPhotosystem II D1 precursor processing protein PSB27-H2, chloroplastic
- GenePSB27-2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids199 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Required, but not essential, for D1 (psbA) precursor processing and thus correct photosystem II assembly (PSII).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | chloroplast thylakoid lumen | |
Cellular Component | cytosol | |
Cellular Component | photosystem II | |
Biological Process | photosystem II assembly | |
Biological Process | photosystem II repair |
Names & Taxonomy
Protein names
- Recommended namePhotosystem II D1 precursor processing protein PSB27-H2, chloroplastic
- Short namesPsb27-H2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9ZVZ9
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Associated with PSII on the lumenal side of the thylakoid membrane.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
A high chlorophyll fluorescence mutant. Impaired PSII function, maximum photochemical efficiency of PSII was decreased, about 25% PSII in thylakoids; severely reduced growth, decreased chlorophyll content. Inefficient processing of the D1 precursor to the mature form.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 16 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | ?-67 | Thylakoid | ||||
Sequence: MGFLVAVMNFSPTLVHHHMKSKPQCQNEKLRQGQTSSLFDRRGFLKCVVGASSFMATIEFSGLQAQA | ||||||
Transit peptide | 1-? | Chloroplast | ||||
Chain | PRO_0000422926 | 68-199 | Photosystem II D1 precursor processing protein PSB27-H2, chloroplastic | |||
Sequence: SEEKLDEGEGVVGAFKTLFDPNERTKSGKELPKAYLKSAREVVKTMRESLKENPKDNAKFRRSADAAKESIRDYLSNWRGQKTVAGEESYVELENVIRALAKFYSKAGPSAPLPDEVKTEILDDLNKAEEFL |
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length199
- Mass (Da)22,267
- Last updated1999-05-01 v1
- Checksum5A36A68A408EB73C
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1P8ASY3 | A0A1P8ASY3_ARATH | LPA19 | 145 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 122 | in Ref. 4; BAC42906 | ||||
Sequence: K → R |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC005106 EMBL· GenBank· DDBJ | AAF79740.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE27833.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF370242 EMBL· GenBank· DDBJ | AAK44057.1 EMBL· GenBank· DDBJ | mRNA | ||
AY142580 EMBL· GenBank· DDBJ | AAN13149.1 EMBL· GenBank· DDBJ | mRNA | ||
AK118288 EMBL· GenBank· DDBJ | BAC42906.1 EMBL· GenBank· DDBJ | mRNA |