Q9ZUG4 · MTNA_ARATH
- ProteinMethylthioribose-1-phosphate isomerase
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids374 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Catalyzes the interconversion of methylthioribose-1-phosphate (MTR-1-P) into methylthioribulose-1-phosphate (MTRu-1-P).
Catalytic activity
- S-methyl-5-thio-alpha-D-ribose 1-phosphate = S-methyl-5-thio-D-ribulose 1-phosphate
Pathway
Amino-acid biosynthesis; L-methionine biosynthesis via salvage pathway; L-methionine from S-methyl-5-thio-alpha-D-ribose 1-phosphate: step 1/6.
Features
Showing features for site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 173 | Transition state stabilizer | ||||
Sequence: C | ||||||
Active site | 253 | Proton donor | ||||
Sequence: D |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrion | |
Cellular Component | nucleus | |
Cellular Component | plasmodesma | |
Molecular Function | S-methyl-5-thioribose-1-phosphate isomerase activity | |
Biological Process | L-methionine salvage from methylthioadenosine | |
Biological Process | L-methionine salvage from S-adenosylmethionine |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameMethylthioribose-1-phosphate isomerase
- EC number
- Short namesM1Pi ; MTR-1-P isomerase
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9ZUG4
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylserine | ||||
Sequence: S | ||||||
Chain | PRO_0000401989 | 2-374 | Methylthioribose-1-phosphate isomerase | |||
Sequence: SGEGDTTLKAICYKPGSLQLLDQRKLPLETIYLEIRDASDGWSAIQEMVVRGAPAIAIAAALSLAVEVFNFHGFDGSASDAVAFLENKLDYLVSSRPTAVNLADAALKLKHVIAKALATATEAKSIFKAYIEASEDMLEDDVVSNKAIGNFGLSLLRQQAKNPDKLSVLTHCNTGSLATAGYGTALGVIRALHTQGILERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRVDGVIVGADRVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEERSPKELMHTHGGLGERIAAPGISVWNPAFDMTPAELIAGIITEKGVITKNGNDTFDISSFAKKITGNSSR |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Sequence similarities
Belongs to the eIF-2B alpha/beta/delta subunits family. MtnA subfamily.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9ZUG4-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length374
- Mass (Da)39,612
- Last updated2002-06-01 v2
- ChecksumA3987D0DA8D27E37
Q9ZUG4-2
- Name2
- Differences from canonical
- 1-48: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A8MRP9 | A8MRP9_ARATH | MTI1 | 328 |
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_040227 | 1-48 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 61 | in Ref. 4; AAM65143 | ||||
Sequence: A → T | ||||||
Sequence conflict | 109 | in Ref. 3; BX820068 | ||||
Sequence: K → R | ||||||
Sequence conflict | 311 | in Ref. 4; AAM65143 | ||||
Sequence: M → L |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC005970 EMBL· GenBank· DDBJ | AAC95160.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC05975.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC05976.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC05977.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX820068 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
AY087601 EMBL· GenBank· DDBJ | AAM65143.1 EMBL· GenBank· DDBJ | mRNA | ||
AY099595 EMBL· GenBank· DDBJ | AAM20446.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AY128839 EMBL· GenBank· DDBJ | AAM91239.1 EMBL· GenBank· DDBJ | mRNA |