Q9ZU77 · GGPP7_ARATH
- ProteinGeranylgeranyl pyrophosphate synthase 7, chloroplastic
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids347 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Catalyzes the trans-addition of the three molecules of IPP onto DMAPP to form geranylgeranyl pyrophosphate.
Catalytic activity
- dimethylallyl diphosphate + isopentenyl diphosphate = (2E)-geranyl diphosphate + diphosphate
Cofactor
Note: Binds 2 Mg2+ ions per subunit.
Pathway
Isoprenoid biosynthesis; farnesyl diphosphate biosynthesis; farnesyl diphosphate from geranyl diphosphate and isopentenyl diphosphate: step 1/1.
Isoprenoid biosynthesis; geranyl diphosphate biosynthesis; geranyl diphosphate from dimethylallyl diphosphate and isopentenyl diphosphate: step 1/1.
Isoprenoid biosynthesis; geranylgeranyl diphosphate biosynthesis; geranylgeranyl diphosphate from farnesyl diphosphate and isopentenyl diphosphate: step 1/1.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 95 | isopentenyl diphosphate (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 98 | isopentenyl diphosphate (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 127 | isopentenyl diphosphate (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 134 | Mg2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 134 | Mg2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 140 | Mg2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 140 | Mg2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 145 | dimethylallyl diphosphate (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 146 | isopentenyl diphosphate (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 232 | dimethylallyl diphosphate (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 233 | dimethylallyl diphosphate (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 270 | dimethylallyl diphosphate (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 287 | dimethylallyl diphosphate (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 297 | dimethylallyl diphosphate (UniProtKB | ChEBI) | ||||
Sequence: K |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Molecular Function | dimethylallyltranstransferase activity | |
Molecular Function | farnesyltranstransferase activity | |
Molecular Function | geranyltranstransferase activity | |
Molecular Function | metal ion binding | |
Biological Process | carotenoid biosynthetic process | |
Biological Process | farnesyl diphosphate biosynthetic process | |
Biological Process | geranyl diphosphate biosynthetic process | |
Biological Process | geranylgeranyl diphosphate biosynthetic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGeranylgeranyl pyrophosphate synthase 7, chloroplastic
- EC number
- Short namesGGPP synthase 7; GGPS7
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9ZU77
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-39 | Chloroplast | ||||
Sequence: MTTLNLSIFPSVKISSSASIPGFIKIQPFLLRRKLSTVL | ||||||
Chain | PRO_0000402121 | 40-347 | Geranylgeranyl pyrophosphate synthase 7, chloroplastic | |||
Sequence: SVTARDEGIIHNHFDFTSYMIGKANAVNEALDSAVSLREPIKIHEAIRYSLLARGKRVRPVLCIAACELVGGEESVALPAACAVEMIHTMSLIHDDLPCMDNDDLRRGKPTNHKVFGEDVAVLAGDALISFAFEHLATSTAVSPARVVRAIGELAKAIGSKGLVAGQVVDLTSGGMDQNDVGLEVLEFIHVHKTAVLLEAATVLGAIVGGGSDEEVEKLRRFARCIGLLFQVVDDILDVTKSSEELGKTAGKDLIADKLTYPKLMGLEKSKDFADKLLSDAHEQLHGFDSSRVKPLLALANYIAKRQN |
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length347
- Mass (Da)37,390
- Last updated1999-05-01 v1
- ChecksumCC68CD1D22FF8840
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC006135 EMBL· GenBank· DDBJ | AAD12206.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC06786.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DQ446520 EMBL· GenBank· DDBJ | ABE65825.1 EMBL· GenBank· DDBJ | mRNA | ||
DQ652999 EMBL· GenBank· DDBJ | ABK28497.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. |