Q9ZQR8 · LURP1_ARATH
- ProteinProtein LURP1
- GeneLURP1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids207 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Involved in basal defense against virulent oomycetes. Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors (By similarity).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrion | |
Biological Process | defense response to fungus | |
Biological Process | response to salicylic acid |
Names & Taxonomy
Protein names
- Recommended nameProtein LURP1
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9ZQR8
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Phenotypes & Variants
Disruption phenotype
No visible phenotype. Reduced basal and R-protein-mediated disease resistances.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 26 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000399232 | 1-207 | Protein LURP1 | |||
Sequence: MQQPCVIVGSKYCSPNPVGLAIVRKVMKITDGNFVITSADGKLLFKVKDPLFSLHGKRILLDCSGAKVLTLRGKMMTMHDRWQVFRGGSTEEGALLYTVKRSSMIQLAPKLEVFLANNVEEKICDFKVKGAWLDDSCVVYAGDSDTIIAHMCGKQTMRGFFFGKDHFSVTVDKNVDYAFIASLIVILVEIEKAGFITKMTTQMIIGF |
Proteomic databases
Expression
Tissue specificity
Limited to discrete pathogen infection sites in leaves.
Induction
Up-regulated upon infection by oomycetes, but not by bacterial or fungal pathogens.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9ZQR8-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length207
- Mass (Da)22,987
- Last updated1999-05-01 v1
- Checksum225929451BDC17B8
Q9ZQR8-2
- Name2
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1P8B016 | A0A1P8B016_ARATH | LURP1 | 267 | ||
F4IGE9 | F4IGE9_ARATH | LURP1 | 179 | ||
A0A1P8AZY8 | A0A1P8AZY8_ARATH | LURP1 | 239 |
Features
Showing features for sequence conflict, alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC006067 EMBL· GenBank· DDBJ | AAD15461.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC06312.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY070390 EMBL· GenBank· DDBJ | AAL49886.1 EMBL· GenBank· DDBJ | mRNA | ||
BT015680 EMBL· GenBank· DDBJ | AAU15179.1 EMBL· GenBank· DDBJ | mRNA | ||
AK317043 EMBL· GenBank· DDBJ | BAH19736.1 EMBL· GenBank· DDBJ | mRNA |