Q9ZPW2 · APC10_ARATH
- ProteinAnaphase-promoting complex subunit 10
- GeneAPC10
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids192 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex controls several key steps in the cell cycle by mediating the ubiquitination and subsequent degradation of target proteins such as cyclins. The APC/C complex is required for the female gametophyte development and is involved in several other aspects of development. Involved in the control of endoreduplication.
Pathway
Protein modification; protein ubiquitination.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | anaphase-promoting complex | |
Cellular Component | nuclear body | |
Biological Process | anaphase-promoting complex-dependent catabolic process | |
Biological Process | cell division | |
Biological Process | negative regulation of DNA endoreduplication | |
Biological Process | phloem or xylem histogenesis | |
Biological Process | protein ubiquitination | |
Biological Process | regulation of DNA endoreduplication |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAnaphase-promoting complex subunit 10
- Short namesAPC10
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9ZPW2
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000174014 | 1-192 | Anaphase-promoting complex subunit 10 | |||
Sequence: MATESSESEEEGKISGGNYKLIIDDDLREMGKNAAWSVSSCKPGNGVTTLRDDNLETYWQSDGLQPHLINIQFQKKVKLQLVVLYVDFKLDESYTPSKISIRAGDGFHNLKEIKSVELVKPTGWVCLSLSGTDPRETFVNTFMLQIAILSNHLNGRDTHIRQIKVYGPRPNPIPHQPFQFTSMEFLTYSTLR |
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Component of the anaphase promoting complex/cyclosome (APC/C), which is composed of at least 10 subunits. Interacts with CDC20-1, CDC20-2, CDC27A and CDC27B.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9ZPW2 | CDC27A Q06AN9 | 3 | EBI-1749354, EBI-1749373 | |
BINARY | Q9ZPW2 | CDC27B Q8LGU6 | 3 | EBI-1749354, EBI-1668733 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 6-192 | DOC | ||||
Sequence: SESEEEGKISGGNYKLIIDDDLREMGKNAAWSVSSCKPGNGVTTLRDDNLETYWQSDGLQPHLINIQFQKKVKLQLVVLYVDFKLDESYTPSKISIRAGDGFHNLKEIKSVELVKPTGWVCLSLSGTDPRETFVNTFMLQIAILSNHLNGRDTHIRQIKVYGPRPNPIPHQPFQFTSMEFLTYSTLR |
Sequence similarities
Belongs to the APC10 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length192
- Mass (Da)21,750
- Last updated2002-06-01 v2
- Checksum5ADBE0E8F7D12FFC
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 112 | in Ref. 3; AAM64688 | ||||
Sequence: E → D |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC006439 EMBL· GenBank· DDBJ | AAD15507.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC06751.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY087130 EMBL· GenBank· DDBJ | AAM64688.1 EMBL· GenBank· DDBJ | mRNA | ||
BT024912 EMBL· GenBank· DDBJ | ABD94068.1 EMBL· GenBank· DDBJ | mRNA | ||
AK229538 EMBL· GenBank· DDBJ | BAF01391.1 EMBL· GenBank· DDBJ | mRNA |