Q9Z1N6 · SFRP4_MOUSE
- ProteinSecreted frizzled-related sequence protein 4
- GeneSfrp4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids351 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types (PubMed:27355534).
SFRP4 plays a role in bone morphogenesis (PubMed:27355534).
May also act as a regulator of adult uterine morphology and function. May also increase apoptosis during ovulation possibly through modulation of FZ1/FZ4/WNT4 signaling (By similarity).
Has phosphaturic effects by specifically inhibiting sodium-dependent phosphate uptake (By similarity).
SFRP4 plays a role in bone morphogenesis (PubMed:27355534).
May also act as a regulator of adult uterine morphology and function. May also increase apoptosis during ovulation possibly through modulation of FZ1/FZ4/WNT4 signaling (By similarity).
Has phosphaturic effects by specifically inhibiting sodium-dependent phosphate uptake (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | extracellular space | |
Molecular Function | Wnt-protein binding | |
Biological Process | bone morphogenesis | |
Biological Process | canonical Wnt signaling pathway | |
Biological Process | cell differentiation | |
Biological Process | negative regulation of canonical Wnt signaling pathway | |
Biological Process | negative regulation of cell population proliferation | |
Biological Process | negative regulation of JNK cascade | |
Biological Process | negative regulation of non-canonical Wnt signaling pathway | |
Biological Process | non-canonical Wnt signaling pathway | |
Biological Process | positive regulation of canonical Wnt signaling pathway | |
Biological Process | regulation of BMP signaling pathway |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameSecreted frizzled-related sequence protein 4
- Short namesFRP-4; sFRP-4
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9Z1N6
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Mice laking Sfrp4 have increased trabecular bone, reduced cortical-bone thickness, and failure of bone modeling during growth, resulting in wider bones with thinner and mechanically inadequate cortexes.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 22 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-18 | |||||
Sequence: MLRSILVALCLWLRLALG | ||||||
Chain | PRO_0000032552 | 19-351 | Secreted frizzled-related sequence protein 4 | |||
Sequence: VRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSSVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERSFDADCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSLSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSRRSIQWEERLQEQQRTIQDKKQIASRTSRTSRSNPPKSKGRPPAPKPASPKKNIKARSAPKKSNLKKSAS | ||||||
Disulfide bond | 24↔85 | |||||
Sequence: CEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSSVLRFFLCAMYAPIC | ||||||
Disulfide bond | 32↔78 | |||||
Sequence: CRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSSVLRFFLC | ||||||
Glycosylation | 38 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 68 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 69↔108 | |||||
Sequence: CSSVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDC | ||||||
Disulfide bond | 97↔136 | |||||
Sequence: CKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVC | ||||||
Disulfide bond | 101↔125 | |||||
Sequence: CQRARDDCEPLMKMYNHSWPESLAC | ||||||
Glycosylation | 116 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 194 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 240 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the ovary. Localized to granulosa cells of periovulatory follicles and corpora lutea. Weakly expressed in adult tissues including kidney, brain and lung.
Induction
Induced in ovaries by chorionic gonadotropin (CG).
Developmental stage
Only weakly expressed in developing embryo except for developing teeth, eye and salivary gland. In the developing eye, from 12.5 dpc, expressed in the future neural retina, in both the inner and outer cell layers. In the developing teeth, strong expression detected in the developing incisor teeth at 14.5 dpc. Expression localized to the mesenchyme of the dental follicle surrounding the enamel organ only at the early cap stage. Highly expressed in the branching epithelium of the salivary gland.
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 19-139 | FZ | ||||
Sequence: VRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSSVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISP | ||||||
Domain | 178-306 | NTR | ||||
Sequence: CKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSLSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSRRSIQWEERLQEQQRTIQDKKQIAS | ||||||
Region | 293-351 | Disordered | ||||
Sequence: EQQRTIQDKKQIASRTSRTSRSNPPKSKGRPPAPKPASPKKNIKARSAPKKSNLKKSAS | ||||||
Compositional bias | 298-318 | Polar residues | ||||
Sequence: IQDKKQIASRTSRTSRSNPPK | ||||||
Compositional bias | 336-351 | Basic residues | ||||
Sequence: KARSAPKKSNLKKSAS |
Domain
The FZ domain is involved in binding with Wnt ligands.
Sequence similarities
Belongs to the secreted frizzled-related protein (sFRP) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length351
- Mass (Da)40,342
- Last updated1999-05-01 v1
- Checksum6CB0B625920A54FE
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1Y7VJK6 | A0A1Y7VJK6_MOUSE | Sfrp4 | 202 | ||
A0A1Y7VK98 | A0A1Y7VK98_MOUSE | Sfrp4 | 193 | ||
Q8CAH7 | Q8CAH7_MOUSE | Sfrp4 | 365 |
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 99 | in Ref. 4 | ||||
Sequence: S → F | ||||||
Compositional bias | 298-318 | Polar residues | ||||
Sequence: IQDKKQIASRTSRTSRSNPPK | ||||||
Compositional bias | 336-351 | Basic residues | ||||
Sequence: KARSAPKKSNLKKSAS |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF117709 EMBL· GenBank· DDBJ | AAD12306.1 EMBL· GenBank· DDBJ | mRNA | ||
AK080766 EMBL· GenBank· DDBJ | BAC38013.1 EMBL· GenBank· DDBJ | mRNA | ||
BC034853 EMBL· GenBank· DDBJ | AAH34853.1 EMBL· GenBank· DDBJ | mRNA | ||
U88569 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AF364906 EMBL· GenBank· DDBJ | AAL14904.1 EMBL· GenBank· DDBJ | Genomic DNA |